/usr/include/BALL/FORMAT/NMRStarFile.h is in libball1.4-dev 1.4.3~beta1-3.
This file is owned by root:root, with mode 0o644.
The actual contents of the file can be viewed below.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 | // -*- Mode: C++; tab-width: 2; -*-
// vi: set ts=2:
//
#ifndef BALL_FORMAT_NMRSTARFILE_H
#define BALL_FORMAT_NMRSTARFILE_H
#ifndef BALL_FORMAT_CIFFILE_H
# include <BALL/FORMAT/CIFFile.h>
#endif
#ifndef BALL_KERNEL_PROTEIN_H
# include <BALL/KERNEL/protein.h>
#endif
#ifndef BALL_STRUCTURE_PEPTIDES_H
# include <BALL/STRUCTURE/peptides.h>
#endif
#include <vector>
namespace BALL
{
/** NMRStarFile class.
\brief This class provides methods for reading and assigning chemical shifts.
This class provides methods for reading and assigning experimental
chemical shifts from NMRStar files to peptides.
The nested class BALLToBMRBMapper creates a mapping between NMRStar file atoms and
atoms of a chain either based on a trivial mapping @see createTrivialMapping()
or based on a given alignment @see createMapping().
Access to information other than the shifts is provided as well.
<br>
Example code: <br>
\code
System system;
pdb_file >> system;
Chain& chain = *(system.beginChain());
NMRStarFile nmr_file("NMRStarFile_test.bmr");
cout << "File contains " << nmr_file.getNumberOfAtoms() << " chemical shifts" << endl;
cout << "Number of samples: " << nmr_file.getNumberOfSamples() << endl;
NMRStarFile::MolecularSystem nmr_mol_sys = nmr_file.getMolecularInformation();
cout << "Molecular systems name: " << nmr_mol_sys.system_name << endl;
cout << "Number of possible chemical units: " << nmr_mol_sys.getNumberOfChemicalUnits() << endl;
// the chemical units of this file
for (Size k=0; k < nmr_mol_sys.getNumberOfChemicalUnits(); k++)
{
NMRStarFile::MolecularSystem::ChemicalUnit cu = nmr_mol_sys.getChemicalUnit(k);
cout << " " << k << " : " << cu.component_name
<< " " << cu.label << endl;
}
// get the shift data
// NOTE: nmr_file.atom_data_sets_ equals nmr_data !
std::vector<NMRStarFile::NMRAtomDataSet> const& nmr_data = nmr_file.getNMRData();
cout << "Number of shift sets: " << nmr_data.size() << endl;
for (Size k=0; k < nmr_data.size(); k++)
{
cout << " " << k << " shift set name: " << nmr_data[k].name << " -- condition name: " << nmr_data[k].condition << endl;
}
// decide for a chemical unit
NMRStarFile::MolecularSystem::ChemicalUnit cu = nmr_mol_sys.getChemicalUnit(0);
String chemical_unit_label = cu.label;
cout << Peptides::GetSequence(chain) << endl;
cout << nmr_file.getResidueSequence() << endl;
// create a mapping based on an alignment
cout << "Create a mapping... " ;
NMRStarFile::BALLToBMRBMapper mapper(chain, nmr_file, chemical_unit_label);
mapper.createMapping("MKSTGIVRKVDELGR-VVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT",
"MKSTGIVRKVDELGRVV-IPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT");
cout << "Number of mismatches: " << mapper.getNumberOfMismatches() << endl;
cout << "Number of gaps: " << mapper.getNumberOfGaps() << endl;
// assign the shifts
nmr_file.assignShifts(mapper);
cout << "Assigned " << nmr_file.getNumberOfShiftsAssigned()
<< " shifts given " << nmr_file.getNumberOfAtoms() << " chemical shifts." << endl << endl;
...
cout << atom->getProperty(ShiftModule::PROPERTY__EXPERIMENTAL__SHIFT).getFloat() << endl;
...
// get the ChemicalUnit by label
NMRStarFile::MolecularSystem::ChemicalUnit chemical_unit = getChemicalUnitByLabel(chemical_unit_label);
// find the corresponding SampleCondition
if (chemical_unit.shifts && nmr_file.hasSampleCondition(chemical_unit.shifts->condition))
{
NMRStarFile::SampleCondition& condition = nmr_file.getSampleConditionByName(chemical_unit.shifts->condition);
if (condition.hasType("pH"))
pH = condition.values["pH"];
if (condition.hasType("pH*"))
pH = condition.values["pH*"];
if (condition.hasType("temperature"))
temperature = condition.values["temperature"];
if (condition.hasType("pressure"))
pressure = condition.values["pressure"];
cout << "NMR conditions: " << pH << ", " << temperature << ", " << pressure << endl;
}
\endcode
*/
class BALL_EXPORT NMRStarFile
: public CIFFile
{
public:
// constant variables to denote unknown values
static const float FLOAT_VALUE_NA;
static const int INT_VALUE_NA;
static const Position POSITION_VALUE_NA;
/** @name Nested classes
These classes represent the data extracted from NMRStar files.
*/
//@{
/** SampleConditions.
This class includes all information for a set of samples
delivered by a NMRStar file.
All members are public for easy access.
*/
class BALL_EXPORT SampleCondition
{
public:
SampleCondition();
// saveframe name -- referenced in the sample_condition_label
// of the saveframe "assigned_chemical_shifts"
String name;
// Accoring to the NMRStarFile 2.1 documentation
// the first entry MUST BE "_Variable_type".
// This is why we are allowed to map per type :-)
vector<String> types;
StringHashMap<float> values;
StringHashMap<float> errors;
StringHashMap<String> units;
bool hasType(String type) {return values.has(type);}
std::ostream& operator >> (std::ostream& s);
};
/** Samples.
This class includes all information of a NMRStar file sample.
*/
class BALL_EXPORT Sample
{
public:
/** Component.
This class includes all information of a sample component.
All members are public for easy access.
*/
class BALL_EXPORT Component
{
public:
Component();
void clear();
String label;
float concentration_value;
String value_unit;
float concentration_min;
float concentration_max;
String isotopic_labeling;
std::ostream& operator >> (std::ostream& s);
};
Sample();
void clear();
String label;
String type;
String details;
vector <Component> components;
std::ostream& operator >> (std::ostream& s);
};
/** ShiftReferenceElement.
This class includes all information for a shift reference element
for one atom type delivered by a NMRStar file.
All members are public for easy access.
*/
class BALL_EXPORT ShiftReferenceElement
{
public:
ShiftReferenceElement();
String mol_common_name;
String atom_type;
Position isotope_number;
String atom_group;
String shift_units;
float shift_value;
String reference_method;
String reference_type;
float indirect_shift_ratio;
std::ostream& operator >> (std::ostream& s);
};
/** ShiftReferenceSet.
This class includes all information for all sets of shift references
for several atom types delivered by a NMRStar file.
All members are public for easy access.
*/
class BALL_EXPORT ShiftReferenceSet
{
public:
ShiftReferenceSet();
// The saveframe's name = set name
// can be referenced in the saveframe "assigned_chemical_shifts"
String name;
std::vector<ShiftReferenceElement> elements;
std::ostream& operator >> (std::ostream& s);
};
/** NMRAtomData
This class includes all information for one atom
delivered by a NMRStar file.
All members are public for easy access.
*/
class BALL_EXPORT NMRAtomData
{
public:
NMRAtomData();
Position atom_ID;
Position residue_seq_code;
String residue_label;
String atom_name;
char atom_type;
float shift_value;
float error_value;
Position ambiguity_code;
bool operator == (const NMRAtomData& atom) const;
std::ostream& operator >> (std::ostream& s);
};
/** NMRAtomDataSet
This class includes all NMR information concerning a
dataset of atoms delivered by a NMRStar file.
The corresponding condition, reference set, and samples can be looked
up with getSampleConditionByName(),
getShiftReferenceSetByName(), and
getSample().
All members are public for easy access.
*/
class BALL_EXPORT NMRAtomDataSet // _Saveframe_category assigned_chemical_shifts
{
public:
NMRAtomDataSet(NMRStarFile* parent);
String name;
String label;
std::vector<NMRAtomData> atom_data;
String condition;
String reference;
std::vector<String> samples;
std::ostream& operator >> (std::ostream& s);
protected:
NMRStarFile* parent_;
};
/** EntryInformation
This class includes all "entry" information of
a NMRStar file datablock.
All members are public for easy access.
*/
class BALL_EXPORT EntryInformation
{
public:
EntryInformation();
~EntryInformation();
std::ostream& operator >> (std::ostream& s);
void clear();
String entry_type;
String BMRB_accession_code;
String NMR_STAR_version;
String experimental_method;
String submission_date;
};
/** Monomeric Polymer
* This class includes all Monomeric Polymers occuring in this file.
* All members are public for easy access.
*/
class BALL_EXPORT MonomericPolymer
{
public:
/// Database with homolog entries
class BALL_EXPORT HomologDB
{
public:
HomologDB();
std::ostream& operator >> (std::ostream& s);
void clear();
String name;
String accession_code;
String entry_mol_name;
float seq_to_submitted_percentage;
float subject_length;
float seq_identity;
float seq_positive;
float homology_expectation_value;
};
MonomericPolymer();
String label_name;
String type;
String polymer_class;
String common_name;
String name_variant;
float molecular_mass;
String details;
// polymer residue sequence information
int number_of_residues;
String residue_sequence;
// we want to allow things like resid 137A, so we cannot use Index
// key: index -- value: aminoacidname
StringHashMap<String> residues_by_index;
vector<HomologDB> homolog_database_entries;
std::ostream& operator >> (std::ostream& s);
void clear();
};
/** Molecular System
This class includes all system relevant information.
All members are public for easy access.
*/
class BALL_EXPORT MolecularSystem
{
// System related information
public:
class BALL_EXPORT RelatedDB
{
public:
RelatedDB();
std::ostream& operator >> (std::ostream& s);
void clear();
String name;
String accession_code;
String entry_mol_name;
String relation_type;
String details;
};
// Central class for convenience
class BALL_EXPORT ChemicalUnit
{
public:
ChemicalUnit();
std::ostream& operator >> (std::ostream& s);
void clear();
String component_name;
String label;
MonomericPolymer* monomeric_polymer;
NMRAtomDataSet* shifts;
};
MolecularSystem();
~MolecularSystem();
ChemicalUnit const& getChemicalUnit(Position i) const { return chemical_units[i]; }
ChemicalUnit& getChemicalUnit(Position i) { return chemical_units[i]; }
Size getNumberOfChemicalUnits() const {return chemical_units.size(); }
// Name of the molecular system
String system_name;
String abbreviation_common;
vector<ChemicalUnit> chemical_units;
String system_physical_state;
String system_oligomer_state;
String system_paramagnetic;
String system_thiol_state;
/// The systems molecular weigth in dalton
float system_molecular_weight;
// related entries in various DB's
vector<RelatedDB> related_database_entries;
/// ligand information //TODO
std::ostream& operator >> (std::ostream& s);
void clear();
};
/** NMRSpectrometer
* This class includes all NMR spectrometer information.
* All members are public for easy access.
*/
class BALL_EXPORT NMRSpectrometer
{
public:
String name;
String manufacturer;
String model;
float field_strength;
std::ostream& operator >> (std::ostream& s);
};
/** Mapper class between BALL atoms and NMRStar file atom entries.
*
* The main reason for the existence of this class (instead of maps to atompointer,position,position)
* is the python interface, which is greatly simplified.
*/
class BALL_EXPORT BALLToBMRBMapper
{
public:
/** @name Type definitions
*/
//@{
/** BMRMIndex stores the savaframe id and
the index of the atom in the NMRAtomDataSet.
*/
//<saveframe_id, atom_id_in_nmr_atom_data_set>
typedef std::pair<Position, Position> BMRBIndex;
typedef std::map<Atom const* , BMRBIndex> BALLToBMRBMapping;
typedef std::map<const NMRAtomData*, Atom const*> BMRBToBALLMapping;
//TODO: Dont use pointer but something more sophisticated!
//@}
/** @name Constructors and Destructors
*/
//@{
BALLToBMRBMapper();
/** Detailed constructor
@param chain the chain to be mapped to a shift reference set
@param nmr_data the NMRStarFile provinding the chemical shifts for chain
@param chemical_unit the name of the molecular system (chemical unit) storing the atom shifts
*/
BALLToBMRBMapper(Chain const& chain, const NMRStarFile& nmr_data, const String& chemical_unit);
/// Destructor
virtual ~BALLToBMRBMapper() {}
//@}
/** @name Access methods
*/
//@{
/// Get the chain
const Chain* getChain() const {return chain_;}
/// Set the chain
void setChain(Chain const& chain) { chain_ = &chain;
num_mismatches_ = -1;
num_gaps_ = -1;}
/// Set the NMRStar file
void setNMRStarFile(NMRStarFile const& nmrfile) {nmr_data_ = &nmrfile;
num_mismatches_ = -1;
num_gaps_ = -1;}
/// Get the NMRStar file
const NMRStarFile* getNMRStarFile() const {return nmr_data_;}
/// Set the NMRAtomDataSet
void setNMRAtomDataSet(NMRAtomDataSet const& nmr_atom_data_set){nmr_atom_data_set_= &nmr_atom_data_set;}
/// Set the NMRAtomDataSet by chemical unit name
bool setNMRAtomDataSetByName(String const& chemical_unit_name);
// Get the NMRAtomDataSet
const NMRAtomDataSet* getNMRAtomDataSet() const{return nmr_atom_data_set_;}
/// Return the mapping
BALLToBMRBMapping& getBALLToBMRBMapping() {return ball_to_bmrb_map_;}
/// Return the mapping
const BALLToBMRBMapping& getBALLToBMRBMapping() const {return ball_to_bmrb_map_;}
/// Return the mapping
BMRBToBALLMapping& getBMRBToBALLMapping() {return bmrb_to_ball_map_;}
/// Return the mapping
const BMRBToBALLMapping& getBMRBToBALLMapping() const {return bmrb_to_ball_map_;}
/// Return the number of mismatches in the current mapping
int getNumberOfMismatches(){return num_mismatches_;}
/// Return the number of mismatches in the current mapping
int getNumberOfGaps(){return num_gaps_;}
/// Test whether the given nmr atom data is mapped to a structure atom
bool isMapped(const NMRAtomData& nmr_atom) const;
/** Return the atom mapped to the given NMRAtom.
@param atom the NMRAtom
@return the mapped BALL atom. If no atom can be matched a NULL pointer is returned.
*/
const Atom* getBALLAtom(const NMRAtomData& nmr_atom) const;
/** Test, whether an atom is matched to NMRAtom data entry
@return true if the given atom is mapped to an atom in the NMRStar file,else otherwise
*/
bool isMapped(Atom const* atom) const;
/// Return the mapping of the given atom
BMRBIndex operator () (const Atom* atom);
/** Create a trivial mapping between the given chain and the NMRStar file atoms.
NOTE: this mapping only works for very simple cases as we assume no gaps.
@return bool - <tt>true</tt> if creating the mapping was possible
*/
bool createTrivialMapping();
/** Create a mapping between the given chain and the molecular system named chemical_unit
of the given NMRStar file atoms based on the given alignment.
The alignmed sequences should be given in OneLetterCode, where '-' denotes a gap.
@param aligned_ball_sequence the aligned protein or chain aminoacid sequence
@param aligned_nmrstar_sequence the aligned aminoacid sequence of the NMRStar atoms
@return bool - <tt>true</tt> if creating the mapping was possible
*/
bool createMapping(const String& aligned_ball_sequence,
const String& aligned_nmrstar_sequence);
/** Clear the object.
*/
void clear();
//@}
protected:
Peptides::NameConverter name_converter_;
/** @name Atributes
*/
//@{
/// map BALL atoms to NMR atom data
BALLToBMRBMapping ball_to_bmrb_map_;
/// map NMR atom data to BALL atoms
BMRBToBALLMapping bmrb_to_ball_map_;
// NOTE: do *not* attempt to delete these pointers!
const Chain* chain_;
const NMRStarFile* nmr_data_;
const NMRAtomDataSet* nmr_atom_data_set_;
Position nmr_atom_data_set_index_;
int num_mismatches_;
int num_gaps_;
bool valid_;
//@}
private:
const Atom* findNMRAtom_(const NMRAtomData& atom) const;
};
//@}
/** @name Constructors and Destructors
*/
//@{
/** Standard constructor
*/
NMRStarFile();
/** Detailed constuctor.
* Opens the given file and extracts all usefull data (Calls \link read read \endlink).
* @throw Exception::FileNotFound if the file could not be opened
*/
NMRStarFile(const String& file_name, File::OpenMode open_mode = std::ios::in);
/// Destructor.
~NMRStarFile();
//@}
/** @name Access methods
*/
//@{
/** Read an NMRStarFile.
* @throw Exception::ParseError if a syntax error was encountered
*/
bool read();
/* Read an NMRStarFile and assign the shifts to the
given AtomContainer using a trivial standard mapping.
If the AtomContainer is a system, the first chain in chosen.
@param ac AtomContainer to which the NMRStarfile's shift should be assigned.
@return bool - <tt>true</tt> if reading the file was successful
*/
//TODO to be able to use this function, further functions getMapping() and assign() are needed.
bool read(AtomContainer& ac);
/** Assign the shifts to the given AtomContainer as
denoted in the given {\b BALLToBMRBMapper}.
@return bool - <tt>true</tt> if reading the file was successful
@see NMRStarFile::BALLToBMRBMapper
*/
bool assignShifts(BALLToBMRBMapper& ball_to_bmrb_mapping);
/** Assign the shifts to the given
AtomContainer as pointed out in the alignment.
The alignmed sequences should be given in
OneLetterCode, where '-' denotes a gap.
@param ac AtomContainer to which the NMRStarfile's shift should be assigned.
@param chemical_unit the name of the molecular system (chemical unit) storing the atom shifts
@param aligned_ball_sequence the aligned AtomContainers aminoacid sequence
@param aligned_nmrstar_sequence the aligned aminoacid sequence of the NMRStar file atoms
@return bool - <tt>true</tt> if reading the file was successful
*/
bool assignShifts(AtomContainer& ac,
const String& chemical_unit,
const String& aligned_ball_sequence,
const String& aligned_nmrstar_sequence);
/** Return the maximum number of atoms in all shift sets
*/
Size getNumberOfAtoms() const;
/** Return the number of atoms assigned a chemical shift
*/
Size getNumberOfShiftsAssigned() const {return number_of_assigned_shifts_;};
/** Get the extracted data for the atoms
*/
const std::vector<NMRAtomDataSet>& getNMRData() const;
/** Get the entry information
*/
const EntryInformation& getEntryInformation() const {return entry_information_;};
/** Get the molecular information
*/
const MolecularSystem& getMolecularInformation() const {return molecular_system_;};
/** Get the molecular information
*/
MolecularSystem& getMolecularInformation() {return molecular_system_;};
/** Get a chemical unit by name
*/
const MolecularSystem::ChemicalUnit& getChemicalUnitByLabel(String const& label) const;
/** Get a chemical unit by name
*/
MolecularSystem::ChemicalUnit& getChemicalUnitByLabel(String const& label);
/** Return true if the file contains a SampleCondition named name, false otherwise
*/
bool hasSampleCondition(String name);
/** Return true if the file contains a SampleCondition named name, false otherwise
*/
bool hasSampleCondition(String name) const;
/** Get a SampleCondition by its SaveFrame name
*/
SampleCondition& getSampleConditionByName(String name);
/** Get a SampleCondition by its SaveFrame name
*/
const SampleCondition& getSampleConditionByName(String name) const;
/// Get the i-th SampleCondition
SampleCondition& getSampleCondition(Position i) {return sample_conditions_[i];};
/// Get the i-th SampleCondition
const SampleCondition& getSampleCondition(Position i) const {return sample_conditions_[i];};
/// Get the number of sample conditions
Size getNumberOfSampleConditions() const {return sample_conditions_.size();};
/// Get the sample conditions
const std::vector<SampleCondition>& getSampleConditions() const {return sample_conditions_;};
/// Get the sample conditions
std::vector<SampleCondition>& getSampleConditions() {return sample_conditions_;};
// addSampleCondition TODO!!
/// Get the samples
std::vector<Sample> getSamples() const {return samples_;};
//const std::vector<Sample>& getSamples() const {return samples_;};
/// Get the number of samples
Size getNumberOfSamples() const {return samples_.size();};
/// Return true if the file contains a sample named label, false otherwise
bool hasSample(String label) const;
/** Get the i-th sample.
If i is out of size a dummy sample is returned.
*/
Sample getSample(Position i) const;
/** Get the sample with name label.
If no sample with name label exist a dummy sample is returned.
*/
Sample getSample(String label) const;
/// Get the shift reference sets
std::vector<ShiftReferenceSet>& getShiftReferenceSets() {return shift_references_;};
/// Get the shift reference sets
const std::vector<ShiftReferenceSet>& getShiftReferenceSets() const {return shift_references_;};
/// Get the number of shift reference sets
Size getNumberOfShiftReferenceSets() const {return shift_references_.size();};
/// Check if there is a ShiftReferenceSet named name
bool hasShiftReferenceSet(String name);
/// Get the i-th shift reference set
ShiftReferenceSet& getShiftReferenceSet(Position i) {return shift_references_[i];};
/// Get the i-th shift reference set
const ShiftReferenceSet& getShiftReferenceSet(Position i) const {return shift_references_[i];};
/// Get a ShiftReferenceSet by its SaveFrame name
const ShiftReferenceSet& getShiftReferenceSetByName(String name) const;
/// Get a ShiftReferenceSet by its SaveFrame name
ShiftReferenceSet& getShiftReferenceSetByName(String name);
/// Get the spectrometers
std::vector<NMRSpectrometer>& getNMRSpectrometers() {return nmr_spectrometers_;};
/// Get the spectrometers
const std::vector<NMRSpectrometer>& getNMRSpectrometers() const {return nmr_spectrometers_;};
/// Get the number of nmr spectrometers
Size getNumberOfNMRSpectrometers() const {return nmr_spectrometers_.size();};
/// Get the i-th spectrometer
NMRSpectrometer& getNMRSpectrometer(Position i);
/// Get the i-th spectrometer
const NMRSpectrometer& getNMRSpectrometer(Position i) const;
/// Get the spectrometer by its SaveFrame name
NMRSpectrometer& getNMRSpectrometerByName(String name);
/// Get the spectrometer by its SaveFrame name
const NMRSpectrometer& getNMRSpectrometerByName(String name) const;
/// Get the spectrometer manufacturer
String getNMRSpectrometerManufacturer(Position i) const;
/// Get the spectrometer field strength
float getNMRSpectrometerFieldStrength(Position i) const;
/** Get a mutable reference to the MonomericPolymer-information by index
* @throw Exception::OutOfRange if a polymer with this index could not be found
*/
NMRStarFile::MonomericPolymer& getMonomericPolymer(Position i);
/** Get the MonomericPolymer-information by index
* @throw Exception::OutOfRange if a polymer with this index could not be found
*/
const NMRStarFile::MonomericPolymer& getMonomericPolymer(Position i) const;
/** Get a mutable reference to the MonomericPolymer-information by name
* @throw Exception::OutOfRange if a polymer with this name could not be found
*/
NMRStarFile::MonomericPolymer& getMonomericPolymer(const String& name);
/** Get the MonomericPolymer-information by name
* @throw Exception::OutOfRange if a polymer with this name could not be found
*/
const NMRStarFile::MonomericPolymer& getMonomericPolymer(const String& name) const;
/// Get the number of monomeric polymers in the file
Size getNumberOfMonomericPolymers() const {return monomeric_polymers_.size();};
/// Get all Monomeric Polymers
vector<MonomericPolymer> getMonomericPolymers() const {return monomeric_polymers_;};
/// Check if polymer name is already stored is a monomeric polymer
bool hasMonomericPolymer(String name) const;
/** Check if label is a monomeric polymer.
Returns true if a monomer with name chemical_unit_label exists,
false otherwise.
*/
bool isMonomericPolymer(String chemical_unit_label);
/** Add a Monomeric Polymer
NOTE: if a poymer with the same name already exists, it will be overwritten!
*/
//TODO: Store changes/additions as Saveframes also in CIFFile
void addMonomericPolymer(MonomericPolymer mp);
/** Get the sequence of residues of the i-th monomeric polymer in the file.
This method automatically compares the i-th monomeric_polymers' residue sequence
with the actual stored NMR shift data. If there is a mismatch, a warning is given!
If there is a mismatch or there is no monomeric_polymers residue sequence an empty.
@return String amino acid sequence
*/
String getResidueSequence(Position i=0) const;
/// Check, whether this NMRFile provides hydrogen shifts
bool hasHshifts() const {return has_H_shifts_;};
/// Check, whether this NMRFile provides carbon shifts
bool hasCshifts() const {return has_C_shifts_;};
/// Check, whether this NMRFile provides nitrogen shifts
bool hasNshifts() const {return has_N_shifts_;};
//@}
/** @name Equality
*/
//@{
/** Equality operator.
Test if both instances point to the same file.
*/
bool operator == (const NMRStarFile& f) const;
/** Inequality operator
Test if both instances point to different files.
*/
bool operator != (const NMRStarFile& f) const;
/** Clear the object.
*/
void clear();
//@}
private:
/*_ @name NMRStar file specific Help-Methods
*/
//_@{
/// reads the number of chemical shifts
void readEntryInformation_();
/// reads the molecular system name
void readMolSystem_();
/// read the MonomericPolymers
void readMonomericPolymers_();
/// reads the sample conditions
void readSampleConditions_();
/// reads the shift references
void readShiftReferences_();
/// reads the shift datas
void readShifts_();
/// read the samples
void readSamples_();
/// reads the NMR spectrometer data
void readNMRSpectrometer_();
/// find dependencies for the ChemicalUnits
void findDependiencies_();
/// set the characters denoting single non-available values
void setSpecialCharacters_(String characters);
/// check whether the given String denotes a non-available value
bool isValidSingleValue_(String value);
/// returns the value as float, if it is a valid one, or FLOAT_VALUE_NA
float valueToFloat_(String value);
/// returns the value as int, if it is a valid one, or INT_VALUE_NA
int valueToInt_(String value);
/** Apply the shifts read into the AtomContainer as denoted in the mapping.
* We assume, that the file was already read!
* The shifts are stored as a property under the key
* {\b BALL::ShiftModule::PROPERTY__EXPERIMENTAL__SHIFT}
*/
bool assignShifts_(BALLToBMRBMapper& pdb_to_bmrb_mapping);
//_@}
/*_ @name NMRStar file specific attributes
*/
//_@{
/*_ A flag indicating validity of this instance. A sole NMRStarFile
instance cannot be valid, because it does not have any information.
*/
bool valid_;
/// the number of shift data sets
Size number_of_shift_sets_;
/// the number of assigned shifts during the last call of assignShifts()
Size number_of_assigned_shifts_;
/// the general entry data
EntryInformation entry_information_;
/// the system information
MolecularSystem molecular_system_;
/// the data for the atoms is stored here
std::vector<NMRAtomDataSet> atom_data_sets_;
/// the data for different sample sets
std::vector<SampleCondition> sample_conditions_;
/// the samples
std::vector<Sample> samples_;
/// the data for shift references
std::vector<ShiftReferenceSet> shift_references_;
/// the data of nmr spectrometers
std::vector<NMRSpectrometer> nmr_spectrometers_;
/// Monomeric Polymer information
vector<MonomericPolymer> monomeric_polymers_;
/// stores, which shifts are given in the file
bool has_H_shifts_;
bool has_C_shifts_;
bool has_N_shifts_;
// a dummy saveframe
SaveFrame dummy_saveframe_;
// a dummy sample condition
SampleCondition dummy_sample_condition_;
// a dummy sample
Sample dummy_sample_;
// a dummy shift reference set
ShiftReferenceSet dummy_shift_reference_set_;
// a dummy nmr spectrometer
NMRSpectrometer dummy_NMR_spectrometer_;
// a dummy nmr spectrometer
MonomericPolymer dummy_monomeric_polymer_;
/// characters, that denote non-available values
String special_characters_;
//_@}
};
//@}
} // Namespace BALL
#endif // BALL_FORMAT_NMRSTARFILE_H
|