lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.fi.po

msgid ""
msgstr ""
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Yleistä"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Vain luettavissa"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Ensimmäinen kirjain iso muut pieniä"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Lisää := operaattori (saa arvokseen) "

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Sulkeiden korostus"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Rivi"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Rivinumero"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr ""

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Lisää puolipiste"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr ""

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr ""

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Toiminta moniselitteisten tai epäselvien tiedostojen kanssa"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr ""

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Sovelluksen asetukset"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr ""

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr ""

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaattisesti luotavat lomakkeet:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Kun tehdään uusi lomake niin se laitetaan automaattisesti luotaviin lomakkeisiin"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Poista tiedosto automaattisesti"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "Automaattinen sisennys"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr ""

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Poista automaattisesti tyhjät metodit"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Muunna nimi automaattisesti pienillä kirjaimilla kirjoitetuksi"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automaattinen tallennus"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Käytettävissä olevat lomakkeet:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Taustaväri"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(ei alikansiota)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Sama nimi (mutta alikansiossa)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr ""

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr ""

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr ""

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr ""

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr ""

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "Sama kirjainkoko"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr ""

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr ""

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr ""

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "Pienet kirjaimet"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Esikatselu (kun maksimi rivinpituus = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr ""

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr ""

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ISOT KIRJAIMET"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr ""

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr ""

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr ""

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "'Tallenna nimellä'-toiminnossa, tiedoston nimen automaattinen muuntaminen pieniksi kirjaimiksi"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Tarkista yksikäsitteisyys"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Valitse koodilyhennetiedosto (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr ""

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Näytä sulje-painike välilehdellä"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Värikaavio"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr ""

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr ""

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr ""

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr ""

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr ""

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr ""

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr ""

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr ""

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr ""

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr ""

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr ""

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr ""

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr ""

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr ""

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr ""

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Hiiri"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""

#: lazarusidestrconsts.dlgcodegeneration
#, fuzzy
#| msgid "Code"
msgid "Code generation"
msgstr "Koodi"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr ""

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr ""

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr ""

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr ""

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr ""

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr ""

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr ""

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr ""

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr ""

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Vie"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Komentorivin parametrit"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Komentorivin parametrit (ilman ohjelman omaa nimeä)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr ""

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr ""

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr ""

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr ""

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr ""

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr ""

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr ""

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr ""

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr ""

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr ""

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr ""

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr ""

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr ""

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Näytä virheet"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr ""

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr ""

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr ""

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr ""

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr ""

#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr "Käytä näitä kääntäjän asetuksia oletuksena uusissa projekteissa"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr ""

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr ""

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr "Kursori:"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Käyttäjän määrittämä tiedostontarkennin (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr ""

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Editorin oletuskirjasin"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Oletusarvo"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr ""

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Poistetaanko koodilyhenne "

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr ""

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Työpöytä"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Työpöytätiedostot"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Vihjeet"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr ""

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Suunta"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr ""

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr ""

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Alas"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr ""

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr ""

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Lihavoitu"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Alikansio"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Koodilyhenteet"

#: lazarusidestrconsts.dlgedcolor
#, fuzzy
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Väri"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for pascal blocks"
msgstr "Lisää Pascal:n lauserakenteiden lopputekstit."

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Käyttäjän määrittämä tiedostontarkennin"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Viive"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr ""

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Näkymä"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr ""

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr ""

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Koodin täydentäminen"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr ""

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Kursivoitu"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Editorin käyttämä kirjasin"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Editorin käyttämän kirjasimen koko"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr ""

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr ""

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Alleviivaus"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "Ulottuvuuden alkukohta"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Kysy"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Huomaa: Projektin tiedostot ovat kaikki tiedostot projektikansiossa"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Varmistus"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Värit"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Tiedostot"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Apupisteet"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Kieli"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Kohdistusviivat"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Muut"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr ""

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Muut tiedostot"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projekti"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tyyppi"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Lisäpikselien määrä rivien välissä (tekstin erottaminen helpottuu)"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Tiedostopäätteet"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Etsi oletuksena kursorin osoittamaa tekstiä"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Tiedosto"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Aliohjelma"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Kirjaimien väri"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr ""

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr ""

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "FreePascal kääntäjä (%s) löytyy tästä polusta/linkistä"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC:n (FreePascal:n) lähdekoodin kansio"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Lomake-editori"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "Kohdistimen osoittama kohta"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Optiot"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr ""

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Hae sijainti"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "Kaikki"

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr ""

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr ""

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Valitun komponentin (tai valinta-alueen) ilmaiseminen"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Apupisteiden väri"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Apupisteiden väli X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Apupisteiden välinen etäisyys vaakasuunnassa"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Apupisteiden väli Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Apupisteiden välinen etäisyys pystysuunnassa"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr ""

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Virheenjäljitin"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editori"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Käyttöympäristö"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Ohje"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr ""

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Näytä kohdistusviivat"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Vasen reunus"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Reunuksen väri"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Reunuksen leveys"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Vain puolen sivun liikutus (scrollaus) (PageUp- & PageDown-näppäimillä)"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr ""

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Korkeus:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Pienennä Lazaruksen käyttöliittymä ohjelmaa suorittaessa "

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr ""

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr ""

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr ""

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home-näppäin siirtyy koodirivin alkuun sisennykset huomioiden"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr ""

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Koodin täydentäminen"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr ""

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Kehitysympäristön asetukset"

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ohita"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr ""

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr ""

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr ""

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr ""

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr ""

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Lisää välilyönti seuraavien jälkeen"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Lisää välilyönti ennen seuraavia (merkkejä)"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr ""

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr ""

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Yritä pysyä samalla kohtaa eri riveillä (x-paikka)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Näppäinkomennot"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr ""

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr ""

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr ""

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr ""

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Kieli"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr ""

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus:n kansio (oletuksena kaikissa projekteissa)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Vasemmalta:"

#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "väri vasemmalla ja ylhäällä"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr ""

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr ""

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Taso 0 (Ei optimointia)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Rivin katkaisu"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr ""

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr ""

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr ""

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Lue työpöytäasetukset tiedostosta"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Päävalikko"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Näytä projektin lomakkeet (forms)"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Näytä projektin Frame-komponentit"

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Näytä projektin käännösyksiköt (units)"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Make -ohjelman hakupolku"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Oikea marginaali ja vasen reunus"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Valittujen komponenttien ilmaiseminen"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr ""

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Suurin laskijanumero"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Suurin rivinpituus:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Tallessa pidettävien viimeiseksi käytettyjen tiedostojen nimien lukumäärä"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Tallessa pidettävien viimeiseksi käytettyjen projektien lukumäärä"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr ""

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Painike"

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Vasen"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Keskimmäinen"

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Oikea"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Sallittu"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Asetus 1"

#: lazarusidestrconsts.dlgmousefoldgroup2
#, fuzzy
#| msgid "setting 2"
msgid "Setting 2"
msgstr "Asetus"

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr ""

#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr "Hiiri:"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Lisää"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Alas"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Vie"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "Tuo"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Vasen"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Keskimmäinen"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnok
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Oikea"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Muuta"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Ylös"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Painike"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Järjestys"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Hiiri"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Vasen reunus"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Valinta"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Muut toiminnot jotka käyttävät samaa nappia"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr ""

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Monivalinta"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Välilehdet ja ikkunat"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr ""

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nimeäminen"

#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Ei automaattista uudelleen nimeämistä"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Ei korostusta"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Vasen"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Oikea"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr ""

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Riviä ei katkaista kun sitä edellä oli:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Riviä ei katkaista kun sitä seuraa:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Rivin korkeus"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Muut"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Optiot"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr ""

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr ""

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr ""

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr ""

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Vihjetekstit komponenttipaletille"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Oletuksena käytettävä Pascal-kielen tiedostopääte"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr ""

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr ""

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr ""

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Sovellus"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Poista kuvake"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr ""

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Lomakkeet"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Kuvake:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Tuo kuvake"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Muut"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Sovelluksen tiedostoasetukset"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Tallenna kuvake"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr ""

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Tehtävän sovelluksen tiedostonimi:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Nimi:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr ""

#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (Windows only)"
msgstr ""

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Projektikohtaiset asetukset"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Projektin %s asetukset"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Projektin tiedostot"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "Kysy vielä muutoksille vahvistusta"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr ""

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Ominaisuuden nimi"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr ""

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Avaa viimeksi käsitelty projekti Lazaruksen käynnistyksen yhteydessä"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr ""

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Näytä käännösikkuna"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Näytä apupisteet"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Sijoitu apupisteiden avulla"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr ""

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "Säännölliset lausekkeet"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Korvaa kaikki"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "Korvaava"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr ""

#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "väri oikealla ja alhaalla"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Valinta voidaan tehdä hiiren oikean näppäimellä"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Oikea marginaaliviiva"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr ""

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""

#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Luonti"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Valinta"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr ""

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Käyttöympäristö"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Paikalliset"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr ""

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr ""

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr ""

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr ""

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr ""

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Suoritusaikaiset parametrit"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Tallenna työpöytäasetukset tiedostoon"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Tallennettu rivi"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr ""

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr ""

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Ulottuvuus"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr ""

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr ""

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Näytä tiedoston lopussa tyhjää tilaa ('Scrollaa' lopun yli)"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Kursoria liikuttaessa ('scrollatessa') ei välitetä rivinlopusta"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Käyttäjä keskeytti hakemisen"

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Etsitään..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Hakupolut"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "Valittu teksti"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr ""

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr ""

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr ""

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Näytä komponenttien nimet vihjeessä"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr ""

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr ""

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr ""

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr ""

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Näytä editointivihjeet"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Näytä kaikki (hidas)"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr ""

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr ""

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Näytä vihjeet"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Näytä rivinumerot"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Näytä muistutukset"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Näytä ainoastaan virheet"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr ""

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr ""

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Näytä yhteenveto"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr ""

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr ""

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Näytä varoitukset"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr ""

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr ""

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Varmistustiedoston symboli tiedoston tarkenteen loppuun (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Lisätään laskijanumero (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Varmistustiedoston symboli tiedoston tarkenteen eteen (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Kiinnity kohdistusviivojen avulla"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Välilyönnit"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Vihjetekstit työkalupainikkeille"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Lähtökohta"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr ""

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr ""

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr ""

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr ""

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Näytä välilehtien numerot lähdekoodieditorissa"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr ""

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr ""

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Kansio jossa käännetään testiprojektit"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "Etsittävä"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr ""

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr ""

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr ""

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr ""

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Ylhäältä:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Poista turhat välilyönnit rivinlopusta"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr ""

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr ""

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr "Kumoa / Palauta uudelleen"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr ""

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr ""

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "käännösyksikön (Unit) riippuvuudet"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Päivitä"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Tallentamaton rivi"

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Ylös"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Koodin laskostus"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr ""

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr ""

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr ""

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr ""

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr ""

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr ""

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Käytä syntaksin korostusta"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Arvo"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Näytä vasen reunus"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Näytä oikea marginaaliviiva"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "Etsi vain kokonaisia sanoja"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Leveys:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Ikkuna"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Ikkunoiden paikat"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Sanat"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Esikatselu"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr ""

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr ""

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Sijoittele"

#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Poista valittu"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr ""

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr ""

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Järjestys"

#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Yksi taaksepäin"

#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Yksi eteenpäin"

#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Siirrä taainmaksi"

#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Siirrä päällimmäksi"

#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Tallenna lomake XML-tiedostona"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skaalaa"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr ""

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Koko"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Sijoita apupisteiden mukaan"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Sijoita kohdistusviivojen mukaan"

#: lazarusidestrconsts.fdmtaborder
msgid "Tab Order..."
msgstr ""

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Lisää tiedosto"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr ""

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Lisää nämä tiedostot tähän projektiin tai pakettiin"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr ""

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Lisää komponenttipakettiin"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Lisää käännösyksikkö(unit)"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr ""

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr ""

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr ""

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr ""

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr ""

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr ""

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr ""

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr ""

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr ""

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr ""

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr ""

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr ""

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Tiedoston nimi:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Tiedoston nimi"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Tiedosto ei ole Pascal:n käännösyksikkö (unit)"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr ""

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr ""

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr ""

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr ""

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr ""

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr ""

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr ""

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr ""

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal:n käännösyksikön (unit) tiedostopääte on joko .pp tai .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr ""

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr ""

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr ""

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Vaihda tiedostopolkua"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr ""

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr ""

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr ""

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr ""

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr ""

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr ""

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr ""

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr ""

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr ""

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr ""

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr ""

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Käännösyksikön (unit) tiedostonimi:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Käännösyksikön (unit) nimi:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr ""

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr ""

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr ""

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Keskeytä kaikki"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr ""

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Keskeytä projektin lataaminen"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr ""

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Tietoja Lazarus:sta"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Lisenssi: GPL/LGPL%sLazarus on FreePascalin kehitysympäristö jolla voi tehdä (graafisia ja komentorivi) sovelluksia FreePascalille. FreePascal on (L)GPL-lisensoitu (mm oliopohjainen) Pascal kääntäjä joka toimii mm. Linux, Win32, OS/2, Mac OS X ja FreeBSD käyttöjärjestelmissä"

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr ""

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Kiitokset"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Salli etsintäoperandit (mm * ja ?)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr ""

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr ""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Lisää parametrin sulkeet"

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Lisätäänkö tiedosto %s projektiin?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Lisätäänkö käännösyksikkö (unit) hakupolkuun?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr ""

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr ""

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr ""

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Tiedoston tyyppi"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Sisältää Register aliohjelman"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr ""

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr ""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr ""

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr ""

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr ""

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr ""

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? "

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Sijoita"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Kaikki lohkorakenteet vaikuttavat hyviltä."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Kaikki tiedostot"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Aina"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Epäselvä (tai moniselitteinen) tiedosto löytyi"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr ""

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Epäselviä (tai moniselitteisiä) tiedostoja löytyi"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Epäselvä (tai moniselitteinen) käännösyksikkö löytyi"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr ""

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Valittujen komponenttien kiinnitys"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr ""

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr ""

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr ""

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr ""

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Virhe esiintyi kun avattiin projektia %s!%s%sAvataanko tämä projekti uudelleen?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr ""

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#, fuzzy
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Sovellus %sGraafinen lcl/freepascal ohjelma. Ohjelma tehdään Lazaruksella (Näistä suositeltavin vaihtoehto)."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Perus Pascal-ohjelma tiedosto.%sTämä on tarkoitettu lähinnä testaamiseen.%sYleisesti olisi parempi valita jokin uusi projekti kuten esim. sovellus."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Varmistetaan vielä erikseen että korvataanko kyseinen kohta"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Kysytään komponentin nimi välittömästi kun se sijoitetaan suunnitteluaikana lomakkeelle (form) "

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Kysytään tiedoston nimi kun luodaan uusi tiedosto"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Kysy komponentin nimi sitä luodessa"

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr ""

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""

#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Automaattiset ominaisuudet"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Näytetään automaattisesti komponenttimuokkain"

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Käytettävissä olevat komponenttipaketit"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Varmuuskopiointi epäonnistui"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr ""

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr ""

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr ""

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Käännä (Build)"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr ""

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Suorita"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr ""

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr ""

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr ""

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr ""

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Lihavoi muutetut arvot (muut kuin oletusarvot)"

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr ""

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr ""

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Alaosan kiinnitys"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Alareunat"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr ""

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Keskeytä"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr ""

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Keskeytä"

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Jatka"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "Etsi"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "Korvaa"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr ""

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr ""

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr ""

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Peru tämän komponentin lataaminen"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr ""

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Perutaan uudelleen nimeäminen"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Päätason komponenttia ei voida kopioida"

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr ""

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr ""

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Virhe"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr ""

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Vakiot"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Tyhjät rakenteet"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Tyhjät aliohjelmat"

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr ""

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr ""

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr ""

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr ""

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr ""

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr ""

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Keskelle ikkunaa"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Keskilinjat"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr ""

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Ei koskaan automaattisesti. Ainoastaan erikseen käskettäessä."

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr ""

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automaattinen päivitys"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr ""

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr ""

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr ""

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tyypit"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Nimeämättömät vakiot"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Muuttujat"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr ""

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Muunna merkistökoodaus"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Muunna tiedosto"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent..."
msgstr ""

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Merkkitaulukko"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr ""

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Valitse toisenlainen nimi"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Anna nimi uudelle komponentille"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr ""

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Valitse kääntäjän tiedostonimi (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr ""

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Valitse Delphi:n tekemä unit(*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr ""

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr ""

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Valitse Lazarus:n kansio"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Valitse make-työkalun hakupolku"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Valitse nimi"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden tiedoston"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden komponenttipaketin"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden ohjelmointiprojektin"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Valitse ohjelman lähdekoodi (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Lisää, alla olevasta listasta valittu, rakenne. Valitun lohkon ympärille"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr ""

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Ylimääräisten tiedostojen poisto"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Poista tiedostot myös alikansioista"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Säilytä kaikki tekstitiedostot"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Säilytettävien tiedostojen tiedostopäätteet"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Poistettavien tiedostojen tiedostopäätteet"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr ""

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr ""

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Poistetaanko käännösyksikön tiedostopolku?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr ""

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Sulje"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr ""

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr ""

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr ""

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr ""

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Käännä (Build)"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Käännä (Compile)"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Suorita"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr ""

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Komento:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr ""

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr ""

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr ""

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr ""

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr ""

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr ""

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr ""

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr ""

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr ""

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr ""

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr ""

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr ""

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr ""

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr ""

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr ""

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr ""

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Näytä tyhjät metodit"

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr "Näytä käyttämättömät käännösyksiköt (unit)"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Jätä huomioonottamatta vakiot seuraavissa funktioissa"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Jätä huomioonottamatta seuravat nimettömät vakiot"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Lisää"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Lisää koodilyhenne"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr ""

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Muuta"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Kommentti:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Muokkaa koodilyhenteitä"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Virhe"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr ""

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Muokkaa"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Virhe luettaessa %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Lopeta"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Kansio"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nimi:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Tiedoston tallentaminen ei onnistunut"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "At (@)"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Kaksoispiste (:)"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Pilkku (,)"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Tunniste (mm muuttuja)"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Numero"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Piste (.)"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puolipiste (;)"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Välilyönnit"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr ""

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr ""

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr ""

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr ""

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr ""

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr ""

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr ""

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr ""

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr ""

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr ""

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr ""

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr ""

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Virhe: toimimaton kääntäjä: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr ""

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Vihje: voitte asettaa kääntäjän halupolun Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehdessä"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr ""

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr ""

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Kääntäjän optiot projektissa: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (käännetään ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr ""

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr ""

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr ""

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Komponentin nimi (name) %s%s%s ei ole sallittu tunnus"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Etsi komponentti"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Avaa paketti"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Avaa käännösyksikkö (unit)"

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr ""

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr ""

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr ""

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr ""

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Vahvista seuraavat muutokset"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Haluatteko uudelleen muodostaa (eli kääntää) Lazaruksen?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Vahvista uusi komponettipakettien joukko kehitysympäristöön"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Uusi komponenttipakettien joukko"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Vanha komponenttipakettien joukko"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Komentorivisovellus"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr ""

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Jatka"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr ""

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Tekijät"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr ""

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr ""

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr ""

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr ""

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Muunna"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Muunna merkistö"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Muunna projektin tai komponettipaketin merkistön koodaus"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlaz
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphi
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazwinonly
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr ""

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr ""

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kokonaisen lomakkeen (form) kopioiti ei ole tuettuna."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kopio valitut kääntäjän viestit leikepöydälle"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr ""

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr ""

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr ""

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr ""

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr ""

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr ""

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Avaa komponenttipaketti %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Avaa käännösyksikkö %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr ""

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Luo funktio"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Luodaan uusi projekti"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr ""

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr ""

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr ""

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr ""

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr ""

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr ""

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr ""

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Lyhenteet"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr ""

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr ""

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr ""

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr ""

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr ""

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr ""

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr ""

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr ""

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#, fuzzy
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Erikoisohjelma%sFreepascal ohjelma."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Olla peräisin"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Virheenjäljitintä (debugger) ei ole valittu"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Merkitse tämä kuitenkin keskeyskohdaksi"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Kun virheenjäljitintä (debugger) ei ole valittu niin keskeytyskohdalla (breakpoint) ei ole vaikutusta ennenkuin 'Käyttöliittymä'-valikon 'Virheenjäljittimen asetus'-kohtaan on asetettu virheenjäjitin."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr ""

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr ""

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Virheenjäljitin"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Ikkuna"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr ""

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr ""

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr ""

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr ""

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Poistetaanko kaikki nämä tiedostot?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr ""

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr ""

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr ""

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Poistetaanko %s%s%s-niminen vanha fiedosto?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Poistetaanko vanha tiedosto?"

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr ""

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr ""

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr ""

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr ""

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr ""

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr ""

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr ""

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Kirjaimen koolla ei väliä"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Jätä huomiotta tyhjät rivit"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Jätä huomiotta erilaiset rivinloppumerkinnät (esim. #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Jätä huomiotta välilyöntien määrä merkkien välissä "

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Jätä välilyönnit huomiotta (ei koske tyhjiä rivejä)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Jätä huomiotta välilyönnit rivin lopussa"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Jätä huomiotta välilyönnit rivin alussa"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Ainoastaan valittu osa"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Avaa eroavuudet editorissa"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Teksti 1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Teksti 2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Ohjeet kääntäjälle"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr ""

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Hylkää muutokset"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Muuttuneet tiedostot:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klikkaa jotain ylläolevaa kohtaa nähdäksesi muuttuneet kohdat"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Jätä huomiotta tallennetun version muutokset"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Hae tallennettuna oleva versio"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Seuraava tiedosto on muuttunut (seuraavat tiedostot ovat muuttuneet):"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Erottelee pienet ja isot kirjaimet (esim. A ja a )"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr ""

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Ei sittenkään suljeta Lazarusta"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Ei suljetakaan projektia"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr ""

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Älä näytä tätä viestiä enään"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Näytä kohdistusviivat"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopioi valitut komponentit leikepöydälle"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Leikkaa valitut komponentit leikepöydälle"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr ""

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr ""

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr ""

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Liitä komponentit leikepöydältä"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr ""

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Valitse näppäinkaavio"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr ""

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr ""

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr ""

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr ""

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr ""

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr ""

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr ""

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr ""

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr ""

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr ""

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr ""

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Muokkaa työkalua"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametrit:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Ohjelman tiedostonimi"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr ""

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr ""

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Kaikki"

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Tyhjät metodit (luokan tyhjät aliohjelmarungot)"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Löydetyt tyhjät metodit:"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Vain published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Poista metodit"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Haetaan näistä luokan (class) osista:"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Sallittu"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr ""

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr ""

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Lisää lauserakenne"

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr ""

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Merkistö on tiedostossa %s%s%s%skoodattu %s-koodauksella. Muunnetaanko tiedoston uudeksi merkistön koodaukseksi %s."

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr ""

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr ""

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Kansiota ei löytynyt"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "FPC:n (FreePascal:n) lähdekoodin kansiota \"%s\" ei löytynyt."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Kääntäjän tiedostonimi on virheellinen"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Kääntäjän tiedosto \"%s\" ei ole ajettavissa."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr ""

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr ""

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#, fuzzy
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Kansio \"%s\" ei vaikuta FreePascalin lähdekoodin kansiolta! Senhän pitäisi sisältää sellaisia kansioita kuten  rtl, packages, compiler jne."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Kansio \"%s\" ei vaikuta Lazarus:n kansiolta! Senhän pitäisi sisältää mm seuraavia kansioita kuten lcl, debugger, designer, components jne."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr ""

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr ""

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Lazarus:n kansiota \"%s\" ei löytynyt."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testiprojektien kansiota \"%s\" ei löytynyt. "

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr ""

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr ""

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr ""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Virhe: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr ""

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr ""

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr ""

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr ""

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Virhe siirrettäessä komponenttia"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Virhe siirrettäessä %s:%s komponenttia"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr ""

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Virheet"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr ""

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Rivinumeroiden näyttöväli:"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr ""

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Virheejäljettimen kiinniottaman poikkeuksen havainto"

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr ""

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr ""

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr ""

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr ""

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr ""

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr ""

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Ohjelman suoritus on pysäytetty"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr ""

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr ""

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr ""

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr ""

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr ""

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr ""

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr ""

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Laajennetaanko käännösyksikön tiedostopolkua?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Tee aliohjelma"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Ulkopuoliset työkalut"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr ""

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr ""

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Alas"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Ylös"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Poista"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr ""

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr ""

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Vähennä näytön päivittämistä"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Piirretään suunnitteluaikaiset kohdat joutoaikana (vähentää hitaiden tietokoneiden kuormitusta)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Tiedeosto %s%s%s on muuttunut. Talletetaanko?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Tiedoston tallentaminen ei onnistunut"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr ""

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Tiedostoa ei löytynyt"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Tiedostoa %s%s%s ei löytynyt.%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Tiedostoa %s%s%s ei löytynyt.%sHaluatko luoda sen?%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr ""

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Tiedosto ei ole tekstitiedosto"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "Tiedoston asetukset ..."

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr ""

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr ""

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "Sama kirjainkoko"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Kansion lisäasetukset"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Tiedostojen suodatus/maskaus (*;*.*;*.bak?)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Sisällytetään myös alikansiot "

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr ""

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "Säännölliset lausekkeet"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Hae projektin kaikista tiedostoista"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Hae kaikista avoinna olevista tiedostoista"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Etsi kansioista"

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Etsittävä teksti:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Mistä"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "Etsi vain kokonaisia sanoja"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Etsi näppäinyhdistelmä"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "LFM tiedoston korjaus"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Kaikesta huolimatta nimetään näin"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr ""

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr ""

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Komponentit"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr ""

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr ""

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Etsi komponenttipaletista komponentti"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Taaksepäin"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr ""

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr ""

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#, fuzzy
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "FreePascal ohjelma joka käyttää TCustomApplication luokkaa. Sillä on helppo tarkastaa komentoriviltä annetut parametrit ja poikkeukset. Ohjelman tekoa hallitaan Lazaruksella."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr ""

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "FreePascalin lähdekoodeja ei löytynyt"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Eteenpäin"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Laajennetaan toiminta koskemaan myös näihin tiedostoihin (esim. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Etsi tai vaihda tunnisteiden nimiä"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Etsi tunnisteet"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Tunniste on: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "vain käytössä oleva lähdekoodiyksikkö (unit)"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "kaikista tämän projektin tiedostoista"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Nimeä uudelleen"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Uudelleen nimeä kaikki tunnisteet"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Uusi nimi on"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Käy kommentit myöskin läpi"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Mistä etsitään"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "Funktio"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr ""

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Mene valitun kohdan osoittamalle lähdekoodiriville"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr ""

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Ohjeen valinta"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr ""

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Vihje: Tarkista sisältääkö kaksi eri komponenttipakettia käännösyksikön samalla nimellä."

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "Vihje: kaksoisnapsauta komentoa jota haluat muokata"

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Avaa"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr ""

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Suorita"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr ""

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Tallenna kaikki"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr ""

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr ""

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Pysäytä"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr ""

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr ""

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Siirry lomakkeen ja käännösyksikön välillä"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Näytä lomakkeet"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Näytä käännösyksiköt (Unit)"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr ""

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Ohjeen asetukset"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr ""

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr ""

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr ""

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Vaakasuunta"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr ""

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr ""

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr ""

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Kehitysympäristön otsikkoteksti alkaa projektin nimellä"

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr ""

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr ""

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr ""

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr ""

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr ""

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr ""

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr ""

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr ""

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr ""

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ohita kaikki"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr ""

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ohita tämän tyyppiset poikkeukset"

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Jätä huomiotta puuttuva tiedosto"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr ""

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr ""

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr ""

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr ""

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr ""

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr ""

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr ""

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Tietoja projektin käännöksestä"

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "Käännetään..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr ""

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Virheitä:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Vihjeitä:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Rivejä:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Keskeytä"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Huomioita:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "Kääntäminen onnistui..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Varoituksia:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Tietoja %s tiedostosta"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr ""

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr ""

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr ""

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Asennus epäonnistui"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr ""

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr ""

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr ""

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr ""

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr ""

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Virheellinen kääntäjän tiedostonimi"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Onnistumaton poisto"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr ""

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr ""

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Virheellinen FreePascalin lähdekoodikansio"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr ""

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Vääränlainen aliohjelman nimi"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Vääränlainen projektitiedoston nimi"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Vääränlainen valinta"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr ""

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s on jo osa projektia."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s on vääränlainen projektin tiedostonimi.%sOle hyvä ja valitse joku muu (esim. projekti1.lpi)"

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr ""

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr ""

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "Pidä"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Hyväksy nimi tälläisenään"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Pidä ne ja jatka"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr ""

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr ""

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr ""

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr ""

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr ""

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr ""

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr ""

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Valitse näppäinkaavio"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr ""

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Sulje kaikki"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Sulje projekti"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr ""

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Kääntäjän optioasetukset"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr ""

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr ""

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#, fuzzy
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Muokkaa asennettuja komponenttipaketteja"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr ""

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr ""

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr ""

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr ""

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr ""

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Kopioi valitut komponentit leikepöydälle"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Leikkaa valitut komponentit leikepöydälle"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Poista viimeksi kirjoitettu merkki"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr ""

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr ""

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr ""

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr ""

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr ""

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Etsi kirjain kerrallaan"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr ""

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr ""

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr ""

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr ""

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr ""

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr ""

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr ""

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr ""

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr ""

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr ""

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Liitä komponentit leikepöydältä"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr ""

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr ""

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr ""

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Suorita ohjelma"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Tallenna kaikki"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Tallenna nimellä"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Tallenna projekti"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Tallenna projekti nimellä"

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr ""

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr ""

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr ""

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr ""

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr ""

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr ""

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr ""

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr ""

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr ""

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr ""

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr ""

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr ""

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr ""

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Näytä käännösyksikön (Unit) tietoja"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr ""

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr ""

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr ""

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr ""

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr ""

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr ""

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr ""

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr ""

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr ""

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr ""

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus komponenttipakettitiedostot"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr ""

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr ""

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Toiminta"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr ""

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Lisää"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr ""

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Käännä (Build)"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr ""

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr ""

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr ""

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr ""

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr ""

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr ""

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr ""

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr ""

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr ""

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Päivitä"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Poista"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Nimeä uudelleen"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr ""

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr ""

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr ""

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr ""

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr ""

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr ""

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr ""

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Vasen"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Vasemman reunan kiinnitys"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr ""

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Vasemmat reunat"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr ""

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Tasot"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM tiedosto"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#, fuzzy
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Kirjasto%sFreePascal kirjasto (.dll windows:ssa, .so linux:ssa, .dylib MacOSX:ssa). Kirjaston lähdekoodia hallitaan Lazarus:lla."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr ""

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr ""

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Arvo"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr ""

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr ""

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr ""

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr ""

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr ""

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr ""

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr ""

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Pääohjelmassa on Application.CreateForm -lause tai -lauseet"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Pääohjelmassa on Application.Title -lause"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Pääohjelman Uses -esittelyosassa on kaikki projektin käännösyksiköt (eli unitit)"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr ""

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr ""

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr ""

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr ""

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr ""

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr ""

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr ""

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Tunniste (mm muuttuja)"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr ""

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr ""

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr ""

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr ""

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr ""

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr ""

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr ""

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr ""

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr ""

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr ""

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr ""

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr ""

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr ""

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr ""

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Lisää hyppy historia"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Lisää editorin tiedosto projektiin"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr ""

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Käännä (Build)"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Käännä kaikki (Build)"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr ""

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with current profile"
msgstr ""

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr ""

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr ""

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Ylimääräisten tiedostojen poisto ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Sulje"

#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Sulje kaikki editorin tiedostot"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Sulje projekti"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr ""

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr ""

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Laita lohko kommentiksi (//)"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Kääntäjän optiot ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Täydennä koodia"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Ehdollinen kääntäminen"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr ""

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr ""

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Muokkaa ulkopuolisia työkaluja ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr ""

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Ohjeen asetukset ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Muunna tiedosto: DPK -> LPK ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Muunna tiedosto: DPR -> LPR ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Muunna tiedosto: Delphi unit -> Lazarus unit ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Muunna tiedosto: DFM -> LFM ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr ""

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopioi"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr ""

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Leikkaa"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr ""

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Eroavuudet"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Muokkaa"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Koodilyhenteet ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr ""

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall packages ..."
msgstr ""

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr "Valikkomuokkain ..."

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Luo alivalikko"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr ""

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Poista valikon kohta"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Siirry käsittelemään tämän kohdan OnClick-tapahtumaa"

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Lisää valmiista malleista..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Lisää uusi valikon kohta (jälkeen)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Lisää uusi valikon kohta (eteen)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Valikkomuokkain"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Siirrä alaspäin (tai oikeallepäin)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Siirrä ylöspäin (tai vasemmallepäin)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr ""

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr ""

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Valitse muokattava valikko (menu)"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Valitse valmis malli:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Mallin esikatselu"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Lauserakenteen lisäys ..."

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Käyttöliittymä"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr ""

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Tee valitusta lohkosta aliohjelma ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Tiedosto"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Etsi"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "Etsi"

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Mene koodilohkon toiseen päähän (begin <-> end)"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Etsi koodilohkon alku"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Etsi kohdistimen osoittaman kohdan määrittely"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Etsi tunnisteiden nimiä ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Etsi tiedostoista ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Etsi &Seuraava"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Etsi &Edellinen"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr ""

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Asetukset ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr ""

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Hyppää riville ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr ""

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr ""

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Ohje"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr ""

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Etsi kirjain kerrallaan"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Sisennä valittu lohko"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr ""

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Lisää merkkitaulukosta"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr ""

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Päivämäärä ja aika"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Yleistä"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr ""

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr ""

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Lisää seuraava teksti"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Käyttäjätunnus"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr ""

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Hyppää takaisin"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Hyppää eteenpäin"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Hyppää"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Mene seuraavaan kirjainmerkkiin"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr ""

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Mene edelliseen kirjainmerkkiin"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr ""

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Muuta pieniksi kirjaimiksi"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr ""

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Uusi Lomake"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Uusi"

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Uusi komponenttipaketti ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Luo uusi Projekti ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Luo uusi projekti tiedostosta ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Uusi käännösyksikkö (Unit)"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr ""

#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Avaa ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Avaa kohdistimen osoittama tiedosto"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Avaa komponenttipaketti ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Avataan komponenttipakettitiedosto (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr ""

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Avaa Projekti ..."

#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Avaa viimeksi esillä olleista ..."

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Avaa esillä ollut komponenttipaketti ..."

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Avaa esillä ollut projekti ..."

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "Komponenttipaketti"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr ""

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr ""

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Liitä"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr ""

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Aliohjelmien ja funktioiden luettelo ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekti"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projektinhallinta"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projektikohtaiset asetukset ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Suorita"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr ""

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr ""

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Nopea syntaksin tarkistus"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""

#: lazarusidestrconsts.lismenuquit
#, fuzzy
#| msgid "Quit"
msgid "&Quit"
msgstr "Lopeta"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Uudelleen"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Poista projektista ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Vaihda tunnisteen nimeä ..."

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Etsi ja korvaa"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "Etsi ja korvaa..."

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr ""

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr ""

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr ""

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Käynnistä Lazarus uudelleen"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Palauta"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "&Suorita"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr ""

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Suoritusaikaiset parametrit..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr ""

#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Tallenna"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Tallenna kaikki"

#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Tallenna nimellä ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Tallenna Projekti"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Tallenna Projekti nimellä  ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Etsi"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Valitse"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Valitse kaikki"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr ""

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Valitse rivi"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr ""

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr ""

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr ""

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr ""

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Lajittele lohko ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr ""

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr ""

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr ""

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Pysäytä"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr ""

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Tietoja"

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Sulje"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr ""

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopioi"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Leikkaa"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr ""

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr ""

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr ""

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Muokkaa"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Lopeta"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Tiedosto"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Etsi"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Etsi seuraava"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Ohje"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Uusi"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Avaa"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Avaa viimeksi esillä olleista"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Liitä"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Uudelleen"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Tallenna"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Tallenna nimellä"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr ""

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr ""

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr ""

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Työkalut"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Poista lohkon kommentointi (//)"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Kumoa"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Poista lohkon sisennys"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Muuta isoiksi kirjaimiksi"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Näytä"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr ""

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr ""

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr ""

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr ""

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr ""

#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Näytä tai poista komponenttipaletti näkyvistä"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponentit"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr ""

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr ""

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Lomakkeet..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr ""

#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "Näytä hyppy historia ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr ""

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Kääntäjän viestit"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Komponenttimuokkain"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Hakutulokset"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "Näytä lähdekoodi"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Lähdekoodi editori"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Tehtävälista (ToDo List)"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Siirry lomakkeen ja käännösyksikön välillä"

#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Näytä käännösyksikön (Unit) riippuvuudet"

#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Näytä käännösyksikön (Unit) tietoja"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Käännösyksiköt eli unitit ..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr ""

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Ikkunat"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Puuttuvia tapahtumia"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Komponenttipaketti puuttuu"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""

#: lazarusidestrconsts.lismore
msgid "More"
msgstr ""

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "Siirrä välilehdelle ..."

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr ""

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Uuden aliohjelman nimi"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr ""

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr ""

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr ""

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr ""

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Tee uusi ohjelma"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Tee uusi tyhjä tekstitiedosto (*.txt)."

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#, fuzzy
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Luo uusi graafinen sovellus.%sOhjelma tehdään ja ylläpidetään Lazaruksella."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Tee uusi pascal käännösyksikkö (unit)"

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Tee uusi standardi paketti.%sPaketti on kokoelma käännösyksiköitä ja komponentteja. Soveltuu pitkälle ehtineille käyttäjille."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Luo uusi käännösyksikkö Frame-komponentiksi"

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Tee uusi unit ja lomake (LCL form)"

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr ""

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr ""

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Uusi merkistö:"

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr ""

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr ""

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr ""

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr ""

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Ei"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Ei varmuuskopioita"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Ei muutoksia"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Ei valittua koodia"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr ""

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr ""

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr ""

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "Ei mikään"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr ""

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr ""

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr ""

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr ""

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr ""

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr ""

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr ""

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr ""

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Luo"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Luo uusi projekti"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr ""

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr ""

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr ""

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr ""

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Luokkaa (Class) %s%s%s ei löydy."

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr ""

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr ""

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr ""

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr ""

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Tiedostonimi: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr ""

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr ""

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr ""

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr ""

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr ""

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Avaa komponenttipaketti"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Komponenttipaketin nimi"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr ""

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr ""

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr ""

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Tila"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr ""

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr ""

#: lazarusidestrconsts.lisok
msgid "&OK"
msgstr ""

#: lazarusidestrconsts.lisold
msgid "old"
msgstr "vanha"

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr ""

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr ""

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Esittävä sana ei voi olla osa toista sanaa"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr ""

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Avataan XML-tiedostona"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Avaa tiedosto"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Avaa tiedosto"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "Avaa tiedosto ..."

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Avaa %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr ""

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Avataan komponenttipakettitiedosto"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Avataanko projekti?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Avaa projekti"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Avaa projekti uudelleen"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Avaa projektitiedosto"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Avaa tiedosto normaalina lähdekoodina"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr ""

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Avataanko projekti %s?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "tai"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Korvataanko tiedosto?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Korvaa tällä tiedostolla"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr ""

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Komponenttipaketin tietoja"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr ""

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr ""

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Komponenttipaketit jotka asennetaan kehitysympäristöön"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr ""

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr ""

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr ""

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Selaa"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr ""

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr ""

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr ""

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr ""

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr ""

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr ""

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr ""

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr ""

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr ""

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Käännä (Compile)"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr ""

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kääntää komponenttipaketin"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr ""

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Kääntäjän asetukset"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr ""

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr ""

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr ""

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr ""

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr ""

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Ohje"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Asenna"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Asenna komponenttipaketti kehitysympäristöön"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr ""

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr ""

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr ""

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr ""

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr ""

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Näytä muut ..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Siirrä riippuvuutta alaspäin"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Siirrä riippuvuutta ylöspäin"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Komponenttipaketti %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Komponenttipaketti %s%s%s on muuttunut.%sTallennetaanko komponenttipaketti?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "komponenttipakettia %s ei ole tallennettu"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Komponenttipaletin välilehti: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Palauta riippuvuus"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr ""

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Tämä on vain luettavissa: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr ""

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr ""

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr ""

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr ""

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr ""

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Poista riippuvuus"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr ""

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr ""

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr ""

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Poista tiedosto"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Poistetaanko tiedosto?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Poistetaanko tiedosto %s%s%s%skomponenttipaketista %s%s%s?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr ""

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Tarvittavat komponenttipaketit"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Talletetaanko muutokset?"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Tallenna komponenttipaketti"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Poista asennuksesta"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr ""

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr ""

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr ""

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Asennetaan seuraavan käynnistyksen yhteydessä"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr ""

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr ""

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Komponenttipakettia %s ei löydetty"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr ""

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr ""

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr ""

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr ""

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Tekijä:"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr ""

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr ""

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr ""

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr ""

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr ""

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr ""

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr ""

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr ""

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr ""

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr ""

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr ""

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Aliohjelmakirjasto"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Lisenssi:"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr ""

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr ""

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr ""

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr ""

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr ""

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr ""

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr ""

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr ""

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr ""

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr ""

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr ""

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr ""

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr ""

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Keskeytä"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr ""

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr ""

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Tiedostonimi:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr ""

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr ""

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr ""

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr ""

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr ""

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr ""

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr ""

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr ""

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr ""

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr ""

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr ""

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Uusi käännösyksikkö (unit) ei ole hakupolussa"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr ""

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr ""

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Tiedosto %s%s%s%sei ole komponenttipaketin hakupolussa.%s%sLisätäänkö kansio %s%s%s käännösyksikköjen hakupolkuun?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Avustusta ei ole vielä tehty"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Näpäyttämällä hiiren oikeaa näppäintä saat esiin ponnahdusvalikon jossa on kaikki saatavissa olevat komponenttipakettiin liittyvät toiminnallisuudet"

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Lista lisätoiminnoista"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Teksti"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr ""

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr ""

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr ""

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaattisesti asennettavat komponenttipaketit"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr ""

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr ""

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr ""

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr ""

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr ""

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Tiedosto on jo projektissa"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr ""

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr ""

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr ""

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Tiedostoa %s%s%s ei löytynyt."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr ""

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr ""

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Asennettaessa komponettipaketti %s tullaan automaattisesti asentamaan paketit:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Virheellinen kääntäjän tiedostonimi"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Vääränlainen tiedoston tarkennin"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr ""

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr ""

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr ""

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr ""

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr ""

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Ei ole suunnitteluaikainen komponenttipaketti"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Komponenttipakettia tarvitaan"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr ""

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr ""

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Rakennetaanko Lazarus uudelleen?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Vaihdetaanko tiedoston nimeä komponenttipaketissa?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr ""

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr ""

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr ""

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Tallenna komponenttipaketti %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr ""

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr ""

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr ""

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Seuraavan komponenttipaketin lataaminen epäonnistui:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Seuraavien komponenttipakettien lataaminen epäonnistui:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sSeuraava käännösyksikkö (unit) lisätään %s-tiedoston uses-lauseeseen :%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Komponenttipaketin %s%s%s kääntäminen epäonnistui.%sPoistetaanko se asennuksesta?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr ""

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Komponenttipaketti %s on ainoastaan ajonaikainen.%sVain ajonaikaisia komponenttipaketteja ei asenneta kehitysympäristöön."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Komponenttipaketti %s%s%s oli merkitty asennettavaksi mutta sitä ei löydetty. Poistetaanko tämä riippuvuus komponettipakettien asennusluettelosta?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Komponenttipakettia %s tarvitaan komponettipaketissa %s, mikä on merkitty asennukseen.%sKatso komponenttipakettien kuvauksista"

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr ""

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr ""

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Komponenttipaketti %s omistaa tiedoston%s%s%s%s.%sPitäisikö tuota komponenttipaketin nimeäkin myöskin muuttaa?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Komponenttipaketti %s%s%s oli merkitty.%sNykyinen Lazarus tukee ainoastaan staattisesti linkitettyjä komponenttipaketteja. komponenttipakettien poistaminen vatii Lazaruksen uudelleen rakentamisen ja käynnistämisen.%s%sTehdäänkö tämä nyt?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Paketti  %s%s%s  on merkitty asennettavaksi.%sNykyinen lazarus tukee ainoastaan staattisesti linkattuja paketteja. Asennus vaatii Lazaruksen uudelleen rakentamisen ja uudelleen käynnistämisen.%s%sHaluako tehdä sen nyt?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Sovellus tarvitsee komponenttipaketin %s%s%s.%sMutta sitä ei löydy (tai ei ole asennettu). Katso projektivalikon kohtaa -> Projektinhallinta."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr ""

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Kansion luonti epäonnistui"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Ei pystytä avaamaan komponenttipakettia  %s%s%s.%sTämä komponenttipaketti oli merkitty asennettavaksi."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Poistetaanko komponenttipaketti Lazaruksen asennuksesta?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Poistetaanko komponenttipaketti %s ?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr ""

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr ""

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Varoitus: Tiedosto %s%s%s%skuuluu jo projektiin."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr ""

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr ""

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr ""

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr ""

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr ""

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr ""

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr ""

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr ""

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr ""

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr ""

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr ""

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr ""

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr ""

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr ""

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr ""

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr ""

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr ""

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr ""

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr ""

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr ""

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr ""

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr ""

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr ""

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Ole hyvä ja valitse ensin jokin koodin osa josta tehdään uusi aliohjelma tai metodi"

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Kaikki>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr ""

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Kopio aliohjelman (/funktion/metodin...) nimi leikepöydälle"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Mene valittuun aliohjelmaan,funktioon..."

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Ei mikään>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "Luokka"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tyyppi"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr ""

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr ""

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ""

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ""

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr ""

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Tulosta"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr ""

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Private - metodi"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr ""

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Aliohjelma"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Aliohjelma ja interface osaan sen esittely"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr ""

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#, fuzzy
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Ohjelma%s Freepascal ohjelma. Ohjelmatiedosto hyödyntää lazarusta."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Tunnistettiin ohjelmaksi"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Ohjelman lähdekoodin tiedosto tarkennin pitää olla .pas, .pp tai .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr ""

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Lisää tiedosto projektiin:"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr ""

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Lisää editorissa avoinna olevia tiedostoja"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Lisää tiedostoja"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr ""

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr ""

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr ""

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr ""

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr ""

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr ""

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr ""

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr ""

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Komponenttipakettia ei löytynyt"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Tarvittavaa komponenttipakettia %s%s%s ei löytynyt.%sJos mahdollista niin valitse jokin toinen komponenttipaketti."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr ""

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Käännösyksikkö (unit) %s%s%s on jo olemassa projektissa%stiedostona: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Lisää projektiin"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Käännösyksikön (Unit) nimi on jo olemassa"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekti on muuttunut"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projektin tallennus on muuttunut"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr ""

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr ""

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr ""

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Tunnistettiin 'Project Info'-tiedostoksi"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr ""

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekti on ajettavissa virheenjäljittimessä"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr ""

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr ""

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr ""

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projekti %s nosti poikkeuksen luokalla '%s' jossa viestinä oli:%s%s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr ""

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built"
msgstr ""

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr ""

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Projektin valinta"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Vahvista riippuvuuden poistaminen"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Vahvista tiedoston poistaminen"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Poistetaanko riippuvuus %s :n ?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Projektinhallinta - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Poistettuja tarvittavia komponenttipaketteja"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Poistetaanko tiedosto %s projektista?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Aina käännetään kaikki (vaikka mikään ei muuttunutkaan)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Virhe"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr ""

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr ""

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr ""

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr ""

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Protected - metodi"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Public - metodi"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Published - metodi"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr ""

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr ""

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr ""

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr ""

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Muunna Delphi-projektista"

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Luo uusi Projekti"

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Avaa Projekti"

#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Avaa viimeksi esillä olleista"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr ""

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Poistu Lazaruksesta"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Lukuvirhe"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr ""

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Arvo"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Suhteelliset hakupolut"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "Poista"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Poista kaikki vikaantuneet tai toimimattomat ominaisuudet"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Poista kaikki käännösyksiköt"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Valitse projektista poistettava käännösyksikkö"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr ""

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr ""

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Poista valitut käännösyksiköt"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Poista ne"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr ""

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Muutetaanko tiedoston nimeä?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr ""

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Vaihda nimi pienillä kirjaimilla kirjoitetuksi"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Avaa projekti uudestaan"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Avaa uudestaan toisella merkistön koodauksella"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr ""

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Resurssitiedoston lukeminen epäonnistui"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr ""

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr ""

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr ""

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr ""

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Paluuarvo:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr ""

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr ""

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Oikea"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Oikean reunan kiinnitys"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr ""

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Oikeat reunat"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr ""

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr ""

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr ""

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr ""

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Tallenna ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Tallenna kaikki kääntäjän viestit tiedostoon"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr ""

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Tallenna ja poistu dialogista"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Tallenna ja käännä kehitysympäristö uudelleen"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Tallennetaanko muutokset?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Tallennetaanko %s -projektiin tehdyt muutokset?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr ""

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr ""

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Tallennetaanko tiedosto %s%s%s%sennenkuin suljetaan lomake (form) %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr ""

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Tallenna "

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr ""

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Viittaukset tunnisteeseen: "

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr ""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Katso \"Kääntäjän viestit \" -ikkunaa"

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sKatso projektivalikon kohtaa -> Projektinhallinta"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Valitse jokin kohta seuraavista:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr ""

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Valitse Delphi form (lomake) tiedosto (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr ""

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Valintatyökalu"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr ""

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr ""

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr ""

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr ""

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr ""

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Näytä komponenttimuokkaimessa vihjeet"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr ""

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Näytä lisätietojaosa"

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr ""

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr ""

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Tuo esille erikoismerkit (kuten välilyönnit pisteinä, kelpaattomat merkit kysymysmerkkeinä)"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr ""

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr ""

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr ""

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Ohita tiedosto ja jatka lataamista"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Löydetty"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr ""

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Normaali (aakkostus)"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Peru"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "Sama kirjainkoko"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Käänteinen (aakkostus)"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Lajittelu peruste"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Jätä välilyönnit huomiotta"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Rivit"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Optiot"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Rivit (sisennykset ovat ed. riviä)"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Esikatselu"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Hyväksy"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Lajittele lohko"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Sanat"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Lähdekoodi muuttunut"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr ""

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr ""

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr ""

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Etsitään"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Etsittävä teksti"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Aloita uusi projekti"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Pysäytetäänkö nykyinen virheenjäljitys ja muodostetaan käännös uudelleen?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Lopetetaanko testaus/virheenjäljitys?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Pysäytetäänkö virheenjäljitys?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Pysäytetäänkö virheenjäljitys?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Outo lpi-tiedosto"

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr ""

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr ""

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr ""

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Aliohjelman sisäinen aliohjelma"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Onnistui"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr ""

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr ""

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s ei ole laillinen tunniste"

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr ""

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr ""

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr ""

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr ""

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr ""

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr ""

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr ""

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr ""

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr ""

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr ""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr ""

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr ""

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Komponentti %s kuuluu luokkaan %s. Komponentin voi poistaa avaamalla kyseisen luokan ja poistamalla sen sieltä."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr ""

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Tällä hetkellä käytössä oleva kääntäjän tiedostonimi %s%s%s%sei ole suoritettavissa.%sValitsemalla Ok käytetään oletuksena olevaa %s%s%s.%sMuussa tapauksessa tarkista Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehden kohdat"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr ""

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Käytössä oleva FreePascalin lähdekoodikansio %s%s%s%sei näytä oikealta. %sValitse Ok käyttääksesi oletuksena olevaa asetusta %s%s%s.%sMuussa tapauksessa tarkista asetukset: Käyttöliittymä -> Asetukset-> Käyttöympäristö -> Tiedostot "

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr ""

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr ""

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr ""

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr ""

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Kansiota %s%s%s ei enään tarvita käännösyksikön tiedostopolussa.%sPoistetaanko se?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr ""

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Kansio %s%s%s ei vielä ole käännösyksikön polussa.%sLisätäänkö se sinne?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Tiedosto %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Tiedosto %s ei vaikuttaisi olevan lpi-tiedosto."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr ""

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr ""

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr ""

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Tiedosto %s%s%s%s näyttää olevan Pascal-ohjelma. Suljetaanko nykyinen projekti ja avataan tämä uutena projektina?%s\"Ei\"-näppäin avaa sen vain lähdekoodina."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Tiedosto %s vaikuttaa siltä että se on ohjelmatiedosto Lazaruksella tehdyssä projektissa."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr ""

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Tiedostoa %s%s%s%sei löytynyt.%sOhita-näppäimen nainallus jatkaa projektin lataamista,%sKeskeytä-näppäin keskeyttää sen."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Seuraavaa metodia %s on käytetty mutta sitä ei löydy lähdekoodista%s%s%s%s%s%sPoistetaanko 'roikkuva' viittaus?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr ""

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "FreePascalin lähdekoodi hakemistoa ei löytynyt. Jotkut toiminnot eivät toimi.%sOn suositeltavaa että lähdekoodit on asennettu ja niiden hakupolku asetettu %sKäyttöliittynä -> Asetukset -> Tiedostot"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr ""

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr ""

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Lazaruksen lomake eli LFM-tiedosto sisältää vääränlaisia ominaisuuksia. Tämä tarkoittanee esimerkiksi jotain luokkaa tai sen ominaisuutta mitä ei ole käytettävissä käytössä olevassa LCL-kirjastossa. Normaali korjaus on poistaa nämä ominaisuudet LFM-tiedostosta ja korjata Pascal-koodi käsin."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Tämän käännösyksikön (unit) polku ei vielä ole hakupolussa.%sLisätäänkö kansio %s hakupolkuun?"

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr ""

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr ""

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Projektn info tiedosto %s%s%s%son/olisi saman niminen kuin projektin pääohjelman lähdekoodi tiedosto!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Tallennettuna oleva projektin lpi-tiedosto (project information file) %s%s%s%son muuttunut."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr ""

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Kansiossa on muitakin saman nimisiä tiedostoja,%sne eroavat ainoastaan kirjaimien koon perusteella:%s%s%sPoistetaanko ne?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Kansiosta löytyy jo myös samanlainen (epäselvä) tiedosto samantapaisella tiedostopäätteellä%sTallennettavatiedosto: %s%sSamanlainen (epäselvä) tiedosto: %s%s%sPoistetaanko samanlainen (epäselvä) tiedosto?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr ""

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Projektissa on jo %s%s%s-niminen lomake (form)"

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr ""

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Käännösyksikön (unit)  %s%s%s nimeä käytetään jo projektissa.%sVoitte kaikesta huolimatta nimetä näin jolloin nimenvaihto tapahtuu,%sMahdollista on myös perua tämä tallennus tai sitten keskeyttää kaikki tallennukset."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Käännösyksikkö (unit) %s löytyy %s:n kahdesta eri käännösyksikön hakupolusta:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr ""

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Käännösyksikössä %s käytetään muitakin tiedostoja.%sPäivitetäänkö viittaukset näihin automaattisesti?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Käännösyksikkö (unit) on jo nimeltään %s%s%s. Pascal:ssa tunnukset pitää olla yksilöllisiä"

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr ""

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Tämä vaikuttaa pascal-tiedostolta.%sOn suositeltavaa käyttää pieniä kirjaimia tiedoston nimessä jotta vältytään ongelmilta joissakin tiedostojärjestelmissä.%Vaihdetaanko tiedoston nimi pienillä kirjaimilla kirjoitetuksi?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tästä ei voi tehdä omaa aliohjelmaa.%sOle hyvä ja valitse ensin jokin muu koodin osa josta voi tehdä uusi aliohjelma tai metodi"

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr ""

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr ""

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr ""

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr ""

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr ""

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr ""

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr ""

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr ""

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr ""

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr ""

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Tiedostopolku:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr ""

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr ""

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Yläosan kiinnitys"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Yläreunat"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr ""

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr ""

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Älä näytä tätä viestiä uudelleen"

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr ""

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr ""

#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Hyppää riville :"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Ei löytynyt"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Korvataanko tässä esiintyvä %s%s%s%s tekstillä %s%s%s?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Etsitään tiedostosta: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Etsittyä merkkijonoa '%s' ei löydetty!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Nykyinen editorin kirjaisin ei tue UTF-8 merkistöä, mutta käyttöjärjestelmä tukee sitä. %sTämä merkitsee sitä että ei ASCII merkit voivat näkyä väärin.%sSopivamman kirjaisimen voi valita editorin asetuksista."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s tavua"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Tyhjennä"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr ""

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "Projektissa:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Rivejä:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nimi:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "ei"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr ""

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr ""

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Koko:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr ""

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr ""

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr ""

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "kyllä"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr ""

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr ""

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr ""

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Ei voida tehdä varmuuskopiota tiedostosta %s%s%s tiedostoon %s%s%s!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr ""

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr ""

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr ""

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr ""

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Tiedoston kopiointi ei onnistunut"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Tiedostoa %s%s%s ei pystytä luomaan"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr ""

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Ei löydetä tiedostoa %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Metodia ei löydetty. Ole hyvä ja korjaa kääntäjän viestin mukainen virhe."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Ei löydetä käännösyksikköä (unit) komponentin luokalle %s%s%s."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Resurssitiedoston lukeminen ei onnistunut.%sResurssitiedosto pitää olla ensimmäisenä tiedostona %sinitialization osassa.%sEli tämän kaltainen määrittely siellä pitäisi olla {$I %s.lrs}.%sTodennäköisesti kyseessä on syntaksivirhe."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr ""

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Ei pystytä lukemaan tiedostoa %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Ei pystytä lukemaan 'project info file'- tiedostoa."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Ei pystytä lukemaan 'project info file'- tiedostoa"

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr ""

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr ""

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr ""

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr ""

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Ei pystytä tekemään muutoksia lähdekoodiin."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Ei pystytä näyttämään metodia. Ole hyvä ja korjaa virhe joka näkyy kääntäjän viestit ikkunassa"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr ""

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr ""

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr ""

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr ""

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Tallentaminen ei onnistunut tiedostoon %s%s%s%sVirheenä oli: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Ei pystytä tallettamaan tiedostoon %s%s%s!"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr ""

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Poista asennuksesta"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Käännösyksikkö (unit) %s%s%s on muuttunut. Talletetaanko?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr ""

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Tätä Käännösyksikön nimeä käytetään jo projektissa"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr ""

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr ""

#: lazarusidestrconsts.lisunitnotfound
#, fuzzy
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Käännösyksikköä (unit) ei löydetty"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr ""

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr ""

#: lazarusidestrconsts.lisunitsnotfound2
#, fuzzy
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Käännösyksikköjä (unit) ei löydetty"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Käyttämättömät käännösyksiköt (unit)"

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr ""

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Päivitetäänkö viittaukset?"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr ""

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr ""

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr ""

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr ""

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versio"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Pystysuunta"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Kopio versiotieto leikepöydälle"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr ""

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Näytä lomakkeen koodi (.lfm)"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Eteenpäin"

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr ""

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "Kun käännösyksikön (unit:n) nimeä muutetaan niin päivitetään viittaukset..."

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr ""

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr ""

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr ""

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr ""

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr ""

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr ""

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr ""

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr ""

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr ""

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr ""

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr ""

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr ""

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Tiedoston tallentaminen ei onnistunut"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "XML tiedostot"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr ""

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Lähdekoodi editori"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr ""

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr ""

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Sulje käytössä oleva välilehti"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr ""

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr ""

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr ""

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr ""

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr ""

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr ""

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr ""

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr ""

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr ""

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr ""

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr ""

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr ""

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr ""

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Näppäin"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "afrikaans"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "arabia"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "oletuskieli (tai englanti)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "katalaani"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "kiina"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "tsekki"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "hollanti"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "englanti"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "suomi"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "ranska"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "saksa"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "heprea"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "indonesia"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "italia"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "japani"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "liettua"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "puola"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "portugali"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "venäjä"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "slovakki"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "espanja"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "turkki"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "ukraina"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr ""

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "Poista"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr ""

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr ""

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Aloita uusi etsintä"

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Arvo"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr ""

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr ""

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Ohjevalikon komennot"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Komentojen komennot"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr ""

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Kursorin siirtokomennot"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Tekstin muokkauskomennot"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Käyttöliittymä valikon komennot"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Tiedostovalikon komennot"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Koodin laskostuskomennot"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Tekstin merkkauskomennot"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Komponenttipakettivalikon komennot"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Projektivalikon komennot"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Suoritavalikon komennot"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Tekstin etsintä- ja korvauskomennot"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Tekstin valintakomennot"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Lähdekoodieditorin komennot"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Työkalutvalikon komennot"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Näytä valikon komennot"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Komento:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr ""

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr ""

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr ""

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr ""

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr ""

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr ""

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr ""

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr ""

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr ""

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr ""

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr ""

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr ""

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr ""

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr ""

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr ""

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr ""

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr ""

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr ""

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr ""

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Täydennä koodia"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr ""

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kopio valittu leikepöydälle"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr ""

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Leikkaa valittu leikepöydälle"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr ""

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Poista kursorin osoittama kirjain"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Poista kirjaimet kursorin osoittamasta paikasta rivin loppuun asti"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Poista edellinen kirjain"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Poista edellinen sana"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr ""

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Poista seuraava sana"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Eroavuudet"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr ""

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr ""

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr ""

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Tee valitusta lohkosta aliohjelma"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr ""

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr ""

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr ""

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr ""

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr ""

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Etsi määrittely"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Etsi tunnisteiden nimiä"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Etsi tiedostoista"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Etsi seuraava"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Etsi sanan seuraava esiintymiskohta"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr ""

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Etsi edellinen"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Etsi sanan edellinen esiintymiskohta"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr ""

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr ""

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr ""

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr ""

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Siirry riville"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr ""

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr ""

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr ""

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr ""

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr ""

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr ""

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Aseta CVS:n avainsana Author"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Aseta CVS:n avainsana Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Aseta CVS:n avainsana Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Aseta CVS:n avainsana ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Aseta CVS:n avainsana Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Aseta CVS:n avainsana Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Aseta CVS:n avainsana Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Aseta CVS:n avainsana Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr ""

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr ""

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr ""

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Rivinvaihto ilman kursorinsiirtoa"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr ""

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr ""

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr ""

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr ""

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Rivinvaihto"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Siirrä kursori rivin loppuun"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr ""

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Siirrä kursori rivin alkuun"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr ""

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Siirry vasemmalla olevalle välilehdelle"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Siirry oikealla olevalle välilehdelle"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Mene seuraavalle välilehdelle"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr ""

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Avaa kohdistimen osoittama tiedosto"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr ""

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr ""

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr ""

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr ""

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr ""

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr ""

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr ""

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Liitä leikepöydältä"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr ""

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Mene edelliselle välilehdelle"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr ""

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr ""

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr ""

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Poista tyhjät metodit"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr ""

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Vaihda tunnisteiden nimiä"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Etsi ja korvaa"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr ""

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr ""

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr ""

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr ""

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr ""

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Tallenna"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr ""

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr ""

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr ""

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr ""

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr ""

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Valitse kaikki"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr ""

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr ""

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr ""

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr ""

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr ""

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr ""

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr ""

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr ""

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr ""

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr ""

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr ""

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr ""

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr ""

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr ""

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr ""

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr ""

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr ""

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr ""

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr ""

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr ""

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr ""

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr ""

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr ""

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr ""

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr ""

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr ""

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr ""

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr ""

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr ""

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr ""

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr ""

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Näytä komponenttimuokkain"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr ""

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr ""

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr ""

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr ""

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr ""

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr ""

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr ""

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr ""

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr ""

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr ""

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Siirrä kursori sanan vasemmalle puolelle (eteen)"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Siirrä kursori sanan oikealle puolelle (loppuun)"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Muokkaa näppäinten merkityksiä"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr ""

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr ""

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Näppäin (tai näppäinpainallusten yhdistelmä)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr ""

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr ""

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Tiedosto on vain luettavissa"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Tiedosto \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" ei voida tallentaa."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr ""

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Kirjainmerkki"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Sulje kaikki muut välilehdet"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "Sulje välilehti"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Täydennä koodia"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopioi"

#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Kopio tiedoston nimi leikepöydälle"

#: lazarusidestrconsts.uemcopytonewwindow
#, fuzzy
#| msgid "Copy to new Window"
msgid "Clone to new Window"
msgstr "Tee uusi näkymä tästä uuteen ikkunaan"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr ""

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Leikkaa"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Virheenjäljitys"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Editorin asetukset"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Lauserakenteen lisäys"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Merkistön koodaus"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr ""

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Tee valitusta lohkosta aliohjelma"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Etsi määrittely"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Etsi tunnisteiden nimiä"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Siirry kirjaimerkkiin"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Syntaksin korostus"

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr ""

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Käännä sijoitus päinvastaiseksi"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "Rivinloppu"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "Siirrä välilehteä vasemmalle"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "Siirrä välilehti vasemmanpuolimmaiseksi"

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "Siirrä välilehteä oikealle"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "Siirrä välilehti oikeanpuolimmaiseksi"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "Siirrä uuteen ikkunaan"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr ""

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Muutettu"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Avaa kohdistimen osoittama tiedosto"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Liitä"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Siirry aliohjelman tai funktion esittelyn ja toteuksen välillä"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Vain luettavissa"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Koodin uudelleen muokkaus"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Vaihda tunnisteen nimeä"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr ""

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Merkitse kirjainmerkiksi"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Näytä rivinumerot"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Käännösyksikön tiedot"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr ""

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr ""

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr ""

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr ""

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr ""

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "Lisää"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "Korvaa"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Vain luettavissa"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Versiotiedot"