/var/lib/mobyle/programs/pratt.xml is in mobyle-programs 5.1.1-1.
This file is owned by root:root, with mode 0o644.
The actual contents of the file can be viewed below.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 | <?xml version='1.0' encoding='UTF-8'?>
<!-- XML Authors: Corinne Maufrais, Nicolas Joly and Bertrand Neron, -->
<!-- 'Biological Software and Databases' Group, Institut Pasteur, Paris. -->
<!-- Distributed under LGPLv2 License. Please refer to the COPYING.LIB document. -->
<program>
<head>
<name>pratt</name>
<version>2.1</version>
<doc>
<title>Pratt</title>
<description>
<text lang="en">Pattern discovery in sets of unaligned protein sequences</text>
</description>
<authors>K. Sturzrehm, I. Jonassen</authors>
<homepagelink>http://www.ii.uib.no/~inge/Pratt.html</homepagelink>
<sourcelink>ftp://ftp.ebi.ac.uk/pub/software/unix/pratt/</sourcelink>
</doc>
<category>sequence:protein:pattern</category>
<command>pratt</command>
</head>
<parameters xmlns:xi="http://www.w3.org/2001/XInclude">
<parameter ismandatory="1" issimple="1">
<name>seq</name>
<prompt lang="en">Sequence File</prompt>
<type>
<datatype>
<class>Sequence</class>
</datatype>
<dataFormat>FASTA</dataFormat>
</type>
<format>
<code proglang="perl">" fasta $value"</code>
<code proglang="python">" fasta "+str(value)</code>
</format>
<argpos>2</argpos>
<comment>
<text lang="en">Fasta format. One file containing all the sequences. One sequence is specified by</text>
<text lang="en">one line starting with '>' in position 1 and then the name of the sequence, and some lines containing the sequence in upper or lower case. The end of a sequence is identified by looking for either the start of a new sequence or the end of the file.</text>
</comment>
<example>
>seq1
HLKSEDEMKASEDLKKHKKKGHHEAEIKPLAQSHATKHKIPVKYLEFIS
SDLHAHKLRKRKLVKNMVL
>seq2
VEVFISEDDLKRKLVKNMVLDKDNKQHMLPKAGDTVTNYTLLGLVLVLI
WLIMQRKRKKKEDVSEENIQEIPKKELAASS
</example>
</parameter>
<paragraph>
<name>conservation</name>
<prompt lang="en">Pattern conservation parameters</prompt>
<argpos>3</argpos>
<parameters>
<parameter>
<name>CM</name>
<prompt lang="en">Minimum number of Sequences to Match (-CM)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<format>
<code proglang="perl">(defined $value)? " -CM $value":""</code>
<code proglang="python">("" , " -CM " + str(value))[ value is not None ]</code>
</format>
<ctrl>
<message>
<text lang="en">Value must be between 2 and 4</text>
</message>
<code proglang="perl">$value >= 2 and $value <= 4</code>
<code proglang="python">value >= 2 and value <= 4</code>
</ctrl>
<comment>
<text lang="en">Set the minimum number of sequences to match a pattern. Pratt will only report patterns that match at least the chosen number of the sequences that you have input. Pratt will not allow you to choose a value higher than the number of sequences input.</text>
</comment>
</parameter>
<parameter>
<name>Cpct</name>
<prompt lang="en">Minimum Percentage of Sequences to Match (-C%)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>100</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -C% $value":""</code>
<code proglang="python">("" , " -C% " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Set the minimum percentage of the input sequences that should match a pattern. If you set this to, say 80, Pratt will only report patterns matching at least 80 % of the sequences input.</text>
</comment>
</parameter>
</parameters>
</paragraph>
<paragraph>
<name>restrictions</name>
<prompt lang="en">Pattern restrictions parameters</prompt>
<argpos>3</argpos>
<parameters>
<parameter>
<name>PP</name>
<prompt lang="en">Position in sequence (-PP)</prompt>
<type>
<datatype>
<class>Choice</class>
</datatype>
</type>
<vdef>
<value>off</value>
</vdef>
<vlist>
<velem>
<value>off</value>
<label>OFF</label>
</velem>
<velem>
<value>complete</value>
<label>Complete pattern match has to be in this area (complete)</label>
</velem>
<velem>
<value>start</value>
<label>Pattern match has to start in this area (start)</label>
</velem>
</vlist>
<format>
<code proglang="perl">(defined $value and $value ne $vdef)? " -PP $value":""</code>
<code proglang="python">("" , " -PP " + str(value))[ value is not None and value != vdef]</code>
</format>
<ctrl>
<message>
<text lang="en">You must give a file to define the area (PF)</text>
</message>
<code proglang="perl">$value eq $vdef or ($value ne $vdef and defined $PF)</code>
<code proglang="python">value == vdef or (value != vdef and PF is not None)</code>
</ctrl>
<comment>
<text lang="en"/>
</comment>
</parameter>
<parameter>
<name>PF</name>
<prompt lang="en">Restriction File name (if PP not off) (-PF)</prompt>
<type>
<datatype>
<class>RestrictionPattern</class>
<superclass>AbstractText</superclass>
</datatype>
</type>
<precond>
<code proglang="perl">$PP ne "off"</code>
<code proglang="python">PP != "off"</code>
</precond>
<format>
<code proglang="perl">" -PF $value"</code>
<code proglang="python">" -PF " + str(value)</code>
</format>
<comment>
<text lang="en">This file contains lines to restrict pattern searches to certain regions in a sequence, say ACE2_YEAST: </text>
<text lang="en">>ACE2_YEAST (100,200)</text>
</comment>
</parameter>
<parameter>
<name>PL</name>
<prompt lang="en">Maximum Pattern Length (-PL)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>50</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -PL $value":""</code>
<code proglang="python">("" , " -PL " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Allows you to set the maximum length of a pattern. The length of the pattern C-x(2,4)-[DE] is 1+4+1=6. </text>
</comment>
</parameter>
<parameter>
<name>PN</name>
<prompt lang="en">Maximum number of Pattern Symbols (-PN)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>50</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -PN $value":" "</code>
<code proglang="python">("" , " -PN " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Using this you can set the maximum number of symbols in a pattern. The pattern C-x(2,4)-[DE] has 2 symbols (C and [DE]).</text>
</comment>
</parameter>
<parameter>
<name>PX</name>
<prompt lang="en">Maximum number of consecutive x's (-PX)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>5</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -PX $value":""</code>
<code proglang="python">("" , " -PX " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Using this option you can set the maximum length of a wildcard.</text>
</comment>
<example>
x - 1
x(10) - 10
x(3,4) - 4
</example>
</parameter>
<parameter>
<name>FN</name>
<prompt lang="en">Maximum number of flexible spacers (-FN)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>2</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -FN $value":""</code>
<code proglang="python">("" , " -FN " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Using this option you can set the maximum number of flexible wildcards (matching a variable number of arbitrary sequence symbols). For instance x(2,4) is a flexible wildcard, and the pattern C-x(2,4)-[DE]-x(10)-F contains one flexible wildcard.</text>
</comment>
</parameter>
<parameter>
<name>FL</name>
<prompt lang="en">Maximum Flexibility (-FL)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>2</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -FL $value":""</code>
<code proglang="python">("" , " -FL " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">You can set the maximum flexibility of a flexible wildcard (matching a variable number of arbitrary sequence symbols). For instance x(2,4) and x(10,12) has flexibility 2, and x(10) has flexibility 0. Increasing FL will increase the time used by Pratt.</text>
</comment>
</parameter>
<parameter>
<name>FP</name>
<prompt lang="en">Maximum Flexibility Product (-FP)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>10</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -FP $value":""</code>
<code proglang="python">("" , " -FP " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en"> Using option FP you can set an upper limit on the product of a flexibilities for a pattern. This is related to the memory requirements of the search, and increasing the limit, increases the memory usage. Some patterns and the corresponding product of flexibilities.</text>
</comment>
<example>
C-x(2,4)-[DE]-x(10)-F - (4-2+1)*(10-10+1)= 3
C-x(2,4)-[DE]-x(10-14)-F - (4-2+1)*(14-10+1)= 3*5= 15
</example>
</parameter>
<parameter>
<name>BI</name>
<prompt lang="en">Input Pattern Symbol File? (-BI)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<vdef>
<value>0</value>
</vdef>
<format>
<code proglang="perl">($value)? " -BI on":""</code>
<code proglang="python">("" , " -BI on")[ value ]</code>
</format>
<comment>
<text lang="en">Using the B options (BN,BI,BF) on the menu you can control which pattern symbols will be used during the initial pattern search and during the refinement phase. The pattern symbols that can be used, are read from a file if the BI option is set, otherwise a default set will be used.</text>
<text lang="en">The default set has as the 20 first elements, the single amino acid symbols, and it also contains a set of ambiguous symbols, each containing amino acids that share some physio-chemical properties</text>
</comment>
</parameter>
<parameter>
<name>BF</name>
<prompt lang="en">Input Pattern Symbol File name (if BI on) (-BF)</prompt>
<type>
<datatype>
<class>PatternSymbol</class>
<superclass>AbstractText</superclass>
</datatype>
</type>
<precond>
<code proglang="perl">$BI</code>
<code proglang="python">BI</code>
</precond>
<format>
<code proglang="perl">(defined $value) ? " -BF $value" : "-BF <xi:include href="../../Local/Services/Programs/Env/pratt_data.xml" xpointer="xpointer(/pratt_data/pattern/text())" />Pratt.sets.big" </code>
<code proglang="python">( " -BF <xi:include href="../../Local/Services/Programs/Env/pratt_data.xml" xpointer="xpointer(/pratt_data/pattern/text())" />Pratt.sets.big" , " -BF " + str(value) )[ value is not None ]</code>
</format>
<comment>
<text lang="en">In the file each symbol is given on a separate line concataining the letters that the symbol should match. For the example, only patterns with the symbols C and [DE] would be considered. During the initial search, pattern symbols corresponding to the first BN lines can be used.</text>
<text lang="en">default file is: Pratt.sets.big</text>
</comment>
<example>
C
DE
</example>
</parameter>
<parameter>
<name>BN</name>
<prompt lang="en">Number of Pattern Symbols Initial Search (-BN)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>20</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -BN $value":""</code>
<code proglang="python">("" , " -BN " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Increasing BN will slow down the search and increase the memory usage, but allow more ambiguous pattern symbols.</text>
</comment>
</parameter>
</parameters>
</paragraph>
<paragraph>
<name>scoring</name>
<prompt lang="en">Pattern Scoring parameters</prompt>
<argpos>3</argpos>
<parameters>
<parameter>
<name>S</name>
<prompt lang="en">Scoring (-S)</prompt>
<type>
<datatype>
<class>Choice</class>
</datatype>
</type>
<vdef>
<value>info</value>
</vdef>
<vlist>
<velem>
<value>info</value>
<label>Information content (info)</label>
</velem>
<velem>
<value>mdl</value>
<label>Minimum Description Length (mdl)</label>
</velem>
<velem>
<value>tree</value>
<label>Diversity calculated from a dendrogram (tree)</label>
</velem>
<velem>
<value>dist</value>
<label>Distances matrix (dist)</label>
</velem>
<velem>
<value>ppv</value>
<label>Positive Predictive Value (ppv)</label>
</velem>
</vlist>
<format>
<code proglang="perl">(defined $value and $value ne $vdef)? " -S $value":""</code>
<code proglang="python">("" , " -S " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">The S option allows you to control the scoring of patterns. There are five possible scoring schemes to be used:</text>
<text lang="en">info: patterns are scored by their information content as defined in (Jonassen et al, 1995). Note that a pattern's score is independent of which sequences it matches.</text>
<text lang="en">mdl: patterns are scored by a Minimum Description Length principle derived scoring scheme, which is related to the one above, but penalises patterns scoring few sequences vs. patterns scoring many. Parameters Z0 to Z3 are required when this scoring scheme is used.</text>
<text lang="en">tree: a pattern is scored higher if it contains more information and/or if it matches more diverse sequences. The sequence diversity is calculated from a dendrogram which has to be input.</text>
<text lang="en">dist: similar to the tree scoring, except a matrix with pairwise the similarity between all pairs of input sequences are used instead of the tree. The matrix has to be input.</text>
<text lang="en">ppv: a measure of Positive Predictive Value - it is assumed that the input sequences constitute a family, and are all contained in the Swiss-Prot database. PPV measures how certain one can be that a sequence belongs to the family given that it matches the pattern.</text>
<text lang="en">For the last three scoring schemes (tree, dist, ppv), an input file is needed.</text>
</comment>
</parameter>
<parameter ismandatory="1">
<name>treefile</name>
<prompt lang="en">Tree File for Scoring equal to tree (-SF)</prompt>
<type>
<datatype>
<class>Tree</class>
</datatype>
</type>
<precond>
<code proglang="perl">$S eq "tree"</code>
<code proglang="python">S == "tree"</code>
</precond>
<format>
<code proglang="perl">" -SF $value "</code>
<code proglang="python">" -SF " + str(value)</code>
</format>
</parameter>
<parameter ismandatory="1">
<name>distfile</name>
<prompt lang="en">Distances File if Scoring equal to dist (-SF)</prompt>
<type>
<datatype>
<class>PhylipDistanceMatrix</class>
<superclass>AbstractText</superclass>
</datatype>
</type>
<precond>
<code proglang="perl">$S eq "dist"</code>
<code proglang="python">S == "dist"</code>
</precond>
<format>
<code proglang="perl">" -SF $value; "</code>
<code proglang="python">" -SF " + str(value)</code>
</format>
<comment>
<text lang="en">A matrix with pairwise the similarity between all pairs of input sequences are used instead of the tree.</text>
</comment>
</parameter>
<parameter>
<name>uniprotdb</name>
<prompt lang="en">Swissprot file if Scoring equal to ppv (-SF)</prompt>
<type>
<datatype>
<class>Sequence</class>
</datatype>
<dataFormat>SWISSPROT</dataFormat>
</type>
<precond>
<code proglang="perl">$S eq "ppv"</code>
<code proglang="python">S == "ppv"</code>
</precond>
<format>
<code proglang="perl">(defined $value) ? " -SF $value" : " -SF <xi:include href="../../Local/Services/Programs/Env/pratt_data.xml" xpointer="xpointer(/pratt_data/db/text())" />" </code>
<code proglang="python">( " -SF <xi:include href="../../Local/Services/Programs/Env/pratt_data.xml" xpointer="xpointer(/pratt_data/db/text())" />" , " -SF " + str(value) )[ value is not None ]</code>
</format>
<comment>
<text lang="en">Default: uniprot_sprot databank.</text>
</comment>
</parameter>
<paragraph>
<name>mdl_param</name>
<prompt lang="en">MDL parameters (Z0-Z3) (if MDL scoring)</prompt>
<precond>
<code proglang="perl">$S eq "mdl"</code>
<code proglang="python">S == "mdl"</code>
</precond>
<argpos>3</argpos>
<parameters>
<parameter ismandatory="1">
<name>Z0</name>
<prompt lang="en">Z0</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>10.00</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -Z0 $value" : "" </code>
<code proglang="python">( "" , " -Z0 " + str(value) )[ value is not None and value != vdef]</code>
</format>
</parameter>
<parameter ismandatory="1">
<name>Z1</name>
<prompt lang="en">Z1</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>10.00</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -Z1 $value" : ""</code>
<code proglang="python">( "" , " -Z1 " + str(value) )[ value is not None and value != vdef]</code>
</format>
</parameter>
<parameter ismandatory="1">
<name>Z2</name>
<prompt lang="en">Z2</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>3.00</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -Z2 $value" : ""</code>
<code proglang="python">( "" , " -Z2 " + str(value) )[ value is not None and value != vdef]</code>
</format>
</parameter>
<parameter ismandatory="1">
<name>Z3</name>
<prompt lang="en">Z3</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>10.00</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -Z3 $value" : ""</code>
<code proglang="python">( "" , " -Z3 " + str(value) )[ value is not None and value != vdef]</code>
</format>
</parameter>
</parameters>
</paragraph>
</parameters>
</paragraph>
<paragraph>
<name>search</name>
<prompt lang="en">Search parameters</prompt>
<argpos>3</argpos>
<parameters>
<parameter>
<name>G</name>
<prompt lang="en">Pattern Graph from: (-G)</prompt>
<type>
<datatype>
<class>Choice</class>
</datatype>
</type>
<vdef>
<value>seq</value>
</vdef>
<vlist>
<velem>
<value>seq</value>
<label>Sequence (seq)</label>
</velem>
<velem>
<value>al</value>
<label>Alignment (al)</label>
</velem>
<velem>
<value>query</value>
<label>Query</label>
</velem>
</vlist>
<format>
<code proglang="perl">(defined $value and $value ne $vdef)? " -G $value":""</code>
<code proglang="python">("" , " -G " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">If G is set to al or query, another option GF is required allowing the user to give the name of a file containing a multiple sequence alignment (in Clustal W format), or a query sequence in FastA format (without annotation). Only patterns consistent with the alignment/matching the query sequence will be considered.</text>
</comment>
</parameter>
<parameter ismandatory="1">
<name>GF_ali</name>
<prompt lang="en">Alignment file (if G set to al) (-GF)</prompt>
<type>
<datatype>
<class>Alignment</class>
</datatype>
<dataFormat>CLUSTAL</dataFormat>
</type>
<precond>
<code proglang="perl">$G eq "al"</code>
<code proglang="python">G == "al"</code>
</precond>
<format>
<code proglang="perl">" -GF $value"</code>
<code proglang="python">" -GF " + str(value)</code>
</format>
<comment>
<text lang="en">Alignment file must be in CLUSTALW format</text>
</comment>
</parameter>
<parameter ismandatory="1">
<name>GF_seq</name>
<prompt lang="en">Query sequence file (if G set query) (-GF)</prompt>
<type>
<datatype>
<class>Sequence</class>
</datatype>
<dataFormat>FASTA</dataFormat>
</type>
<precond>
<code proglang="perl">$G eq "query"</code>
<code proglang="python">G == "query"</code>
</precond>
<format>
<code proglang="perl">" -GF $value"</code>
<code proglang="python">" -GF " + str(value)</code>
</format>
<comment>
<text lang="en">Query file must be in Fasta format</text>
</comment>
</parameter>
<parameter>
<name>E</name>
<prompt lang="en">Search Greediness (-E)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>3</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -E $value":""</code>
<code proglang="python">("" , " -E " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Using the E parameter you can adjust the greediness of the search. Setting E to 0 (zero), the search will be exhaustive. Increasing E increases the greediness, and decreases the time used in the search.</text>
</comment>
</parameter>
<parameter>
<name>R</name>
<prompt lang="en">Pattern Refinement (-R)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<vdef>
<value>1</value>
</vdef>
<format>
<code proglang="perl">($value) ? " -R off" : ""</code>
<code proglang="python">( " " , " -R off" )[ value ]</code>
</format>
<comment>
<text lang="en">When the R option is switched on, patterns found during the initial pattern search are input to a refinement algorithm where more ambiguous pattern symbols can be added. For instance the pattern C-x(4)-D might be refined to C-x-[ILV]-x-D-x(3)-[DEF]</text>
</comment>
</parameter>
<parameter>
<name>RG</name>
<prompt lang="en">Generalise ambiguous symbols (if Pattern Refinement on) (-RG)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<precond>
<code proglang="perl">$R</code>
<code proglang="python">R</code>
</precond>
<vdef>
<value>0</value>
</vdef>
<format>
<code proglang="perl">($value)? " -RG on" : "" </code>
<code proglang="python">( "" , " -RG on" )[ value ]</code>
</format>
<comment>
<text lang="en">If the RG option is switched on, then ambiguous symbols listed in the symbols file (or in the default symbol set -- see help for option B), are used. If RG is off, only the letters needed to match the input sequences are included in the ambiguous pattern positions.</text>
<text lang="en">For example, if [ILV] is a listed allowed symbol, and [IL] is not, [IL] can be included in a pattern if RG is off, but if RG is on, the full symbol [ILV] will be included instead.</text>
</comment>
</parameter>
</parameters>
</paragraph>
<paragraph>
<name>output</name>
<prompt lang="en">Output options</prompt>
<argpos>3</argpos>
<parameters>
<parameter>
<name>OP</name>
<prompt lang="en">PROSITE Pattern Format (-OP)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<vdef>
<value>1</value>
</vdef>
<format>
<code proglang="perl">($value) ? " -OP off " : ""</code>
<code proglang="python">( "" , " -OP off " )[ value ]</code>
</format>
<comment>
<text lang="en">When switched on, patterns will be output in PROSITE style (for instance C-x(2,4)-[DE]). When switched off, patterns are output in a simpler consensus pattern style (for instance Cxx--[DE] where x matches exactly one arbitrary sequence symbol and - matches zero or one arbitrary sequence symbol).</text>
</comment>
</parameter>
<parameter>
<name>ON</name>
<prompt lang="en">Maximum number patterns (-ON)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>50</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -ON $value":""</code>
<code proglang="python">("" , " -ON " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Set the maximum number of patterns to be found by Pratt</text>
</comment>
</parameter>
<parameter>
<name>OA</name>
<prompt lang="en">Maximum number Alignments (-OA)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<vdef>
<value>50</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -OA $value":""</code>
<code proglang="python">("" , " -OA " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Set the max. nr of patterns for which Pratt is to produce an alignment of the sequence segments matching it.</text>
</comment>
</parameter>
<parameter>
<name>M</name>
<prompt lang="en">Print Patterns in sequences (-M)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<vdef>
<value>1</value>
</vdef>
<format>
<code proglang="perl">($value) ? " -M off " : ""</code>
<code proglang="python">( " " , " -M off" )[ value ]</code>
</format>
<comment>
<text lang="en">If the M option is set, then Pratt will print out the location of the sequence segments matching each of the (maximum 52) best patterns. The patterns are given labels A, B,...Z,a,b,...z in order of decreasing pattern score. Each sequence is printed on a line, one character per K-tuple in the sequence. If pattern with label C matches the third K-tuple in a sequence C is printed out. If several patterns match in the same K-tuple, only the best will be printed.</text>
</comment>
</parameter>
<parameter>
<name>MR</name>
<prompt lang="en">Ratio for printing (-MR)</prompt>
<type>
<datatype>
<class>Integer</class>
</datatype>
</type>
<precond>
<code proglang="perl">$M</code>
<code proglang="python">M</code>
</precond>
<vdef>
<value>10</value>
</vdef>
<format>
<code proglang="perl">(defined $value and $value != $vdef)? " -MR $value":""</code>
<code proglang="python">("" , " -MR " + str(value))[ value is not None and value != vdef]</code>
</format>
<comment>
<text lang="en">Sets the K value (ratio) used for printing the summary information about where in each sequence the pattern matches are found.</text>
</comment>
</parameter>
<parameter>
<name>MV</name>
<prompt lang="en">Print vertically (-MV)</prompt>
<type>
<datatype>
<class>Boolean</class>
</datatype>
</type>
<precond>
<code proglang="perl">$M</code>
<code proglang="python">M</code>
</precond>
<vdef>
<value>0</value>
</vdef>
<format>
<code proglang="perl">($value)? " -MV on " : "" </code>
<code proglang="python">( "" , " -MV on " )[ value ]</code>
</format>
<comment>
<text lang="en">If set, the output is printed vertically instead of horizontally, vertical output can be better for large sequence sets.</text>
</comment>
</parameter>
</parameters>
</paragraph>
<parameter isout="1">
<name>outfiles</name>
<prompt lang="en">Output file</prompt>
<type>
<datatype>
<class>Text</class>
</datatype>
</type>
<filenames>
<code proglang="perl">"*.pat"</code>
<code proglang="python">"*.pat"</code>
</filenames>
</parameter>
<parameter isout="1">
<name>report</name>
<prompt lang="en">Report output file</prompt>
<type>
<datatype>
<class>Text</class>
</datatype>
</type>
<filenames>
<code proglang="perl">"report"</code>
<code proglang="python">"report"</code>
</filenames>
</parameter>
</parameters>
</program>
|